Citrus Sinensis ID: 030837

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLVSAKL
cccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHcccccccccc
cccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccEccccEcccccHHHcHHHHccHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHccEEcc
mtknyptvSEDYKKAVEKCKRKLRGfiaekncaPLMLRIAWHsagtydvktktggpfgTMRLAAEQAHSANNGLDIAVRLLepfkeqfptisyaDLYQLAGVVGvevtggpdipfhpgrddkaeppqegrlpdakqgnDHLRQVFGaqmglsdkdivalsgghtlvsakl
mtknyptvsedyKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSgghtlvsakl
MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLVSAKL
**************AVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGP********************************************IVA************
***NYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLVSAKL
*********EDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLVSAKL
***NYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLVSAKL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLVSAKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query170 2.2.26 [Sep-21-2011]
Q05431250 L-ascorbate peroxidase 1, yes no 0.970 0.66 0.787 9e-77
P48534250 L-ascorbate peroxidase, c N/A no 0.988 0.672 0.773 2e-75
Q9FE01251 L-ascorbate peroxidase 2, yes no 0.964 0.653 0.774 2e-73
A2XFC7250 L-ascorbate peroxidase 1, N/A no 0.970 0.66 0.757 4e-73
Q10N21250 L-ascorbate peroxidase 1, no no 0.970 0.66 0.757 4e-73
Q1PER6251 L-ascorbate peroxidase 2, no no 0.964 0.653 0.757 2e-70
Q01MI9 291 Probable L-ascorbate pero N/A no 0.958 0.560 0.628 1e-55
Q0JEQ2 291 Probable L-ascorbate pero no no 0.958 0.560 0.628 1e-55
Q42564 287 L-ascorbate peroxidase 3, no no 0.935 0.554 0.65 3e-54
Q6ZJJ1 291 Probable L-ascorbate pero no no 0.935 0.546 0.618 6e-53
>sp|Q05431|APX1_ARATH L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana GN=APX1 PE=1 SV=2 Back     alignment and function desciption
 Score =  285 bits (729), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 130/165 (78%), Positives = 148/165 (89%)

Query: 1   MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM 60
           MTKNYPTVSEDYKKAVEKC+RKLRG IAEKNCAP+M+R+AWHSAGT+D +++TGGPFGTM
Sbjct: 1   MTKNYPTVSEDYKKAVEKCRRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTM 60

Query: 61  RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD 120
           R  AEQAH AN+G+ IA+RLL+P +EQFPTIS+AD +QLAGVV VEVTGGPDIPFHPGR+
Sbjct: 61  RFDAEQAHGANSGIHIALRLLDPIREQFPTISFADFHQLAGVVAVEVTGGPDIPFHPGRE 120

Query: 121 DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTL 165
           DK +PP EGRLPDA +G DHLR VF  QMGLSDKDIVALSG HTL
Sbjct: 121 DKPQPPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTL 165
Plays a key role in hydrogen peroxide removal. Constitutes a central component of the reactive oxygen gene network.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 1EC: .EC: 1EC: .EC: 1EC: 1
>sp|P48534|APX1_PEA L-ascorbate peroxidase, cytosolic OS=Pisum sativum GN=APX1 PE=1 SV=2 Back     alignment and function description
>sp|Q9FE01|APX2_ORYSJ L-ascorbate peroxidase 2, cytosolic OS=Oryza sativa subsp. japonica GN=APX2 PE=1 SV=1 Back     alignment and function description
>sp|A2XFC7|APX1_ORYSI L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1 Back     alignment and function description
>sp|Q10N21|APX1_ORYSJ L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1 Back     alignment and function description
>sp|Q1PER6|APX2_ARATH L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3 Back     alignment and function description
>sp|Q01MI9|APX3_ORYSI Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1 Back     alignment and function description
>sp|Q0JEQ2|APX3_ORYSJ Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=2 SV=1 Back     alignment and function description
>sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 Back     alignment and function description
>sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query170
221327589250 ascorbate peroxidase 2 [Citrus maxima] 0.970 0.66 1.0 4e-93
300837175250 ascorbate peroxidase [Citrus limon] 0.970 0.66 0.993 2e-92
37783265250 ascorbate peroxidase [Ipomoea batatas] 0.970 0.66 0.842 1e-78
6651272250 ascorbate peroxidase [Pimpinella brachyc 0.970 0.66 0.836 9e-78
151347475250 ascorbate peroxidase [Carica papaya] 0.970 0.66 0.824 6e-77
118482461173 unknown [Populus trichocarpa] 0.994 0.976 0.805 1e-76
27449248250 ascorbate peroxidase [Hevea brasiliensis 0.970 0.66 0.818 1e-76
2754860250 cytosolic ascorbate peroxidase [Fragaria 0.970 0.66 0.824 2e-76
5257550250 cytosolic ascorbate peroxidase [Fragaria 0.970 0.66 0.824 2e-76
27650423175 ascorbate peroxidase [Crocus sativus] 0.970 0.942 0.836 2e-76
>gi|221327589|gb|ACM17464.1| ascorbate peroxidase 2 [Citrus maxima] Back     alignment and taxonomy information
 Score =  345 bits (885), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 165/165 (100%), Positives = 165/165 (100%)

Query: 1   MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM 60
           MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM
Sbjct: 1   MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM 60

Query: 61  RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD 120
           RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD
Sbjct: 61  RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD 120

Query: 121 DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTL 165
           DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTL
Sbjct: 121 DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTL 165

Source: Citrus maxima

Species: Citrus maxima

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|300837175|gb|ADK38619.1| ascorbate peroxidase [Citrus limon] Back     alignment and taxonomy information
>gi|37783265|gb|AAP42501.1| ascorbate peroxidase [Ipomoea batatas] Back     alignment and taxonomy information
>gi|6651272|gb|AAF22246.1| ascorbate peroxidase [Pimpinella brachycarpa] Back     alignment and taxonomy information
>gi|151347475|gb|ABS01350.1| ascorbate peroxidase [Carica papaya] Back     alignment and taxonomy information
>gi|118482461|gb|ABK93153.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|27449248|gb|AAO14118.1|AF457210_1 ascorbate peroxidase [Hevea brasiliensis] Back     alignment and taxonomy information
>gi|2754860|gb|AAB95222.1| cytosolic ascorbate peroxidase [Fragaria x ananassa] gi|5442414|gb|AAD43336.1| cytosolic ascorbate peroxidase [Fragaria x ananassa] Back     alignment and taxonomy information
>gi|5257550|gb|AAD41404.1|AF159629_1 cytosolic ascorbate peroxidase [Fragaria x ananassa] gi|5257554|gb|AAD41406.1|AF159631_1 cytosolic ascorbate peroxidase [Fragaria x ananassa] gi|5442416|gb|AAD43337.1| cytosolic ascorbate peroxidase APX19 [Fragaria x ananassa] Back     alignment and taxonomy information
>gi|27650423|emb|CAD33265.1| ascorbate peroxidase [Crocus sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query170
TAIR|locus:2026616250 APX1 "ascorbate peroxidase 1" 0.970 0.66 0.787 9.9e-71
TAIR|locus:2074914251 APX2 "ascorbate peroxidase 2" 0.952 0.645 0.766 2.8e-66
TAIR|locus:2131586 287 APX3 "ascorbate peroxidase 3" 0.935 0.554 0.65 1.1e-50
TAIR|locus:2125409 279 APX5 "ascorbate peroxidase 5" 0.917 0.559 0.569 4.5e-43
ASPGD|ASPL0000044163 361 ccp1 [Emericella nidulans (tax 0.958 0.451 0.449 3.6e-34
TAIR|locus:2204735 426 TAPX "thylakoidal ascorbate pe 0.876 0.349 0.477 6.7e-33
ASPGD|ASPL0000029968 312 AN5440 [Emericella nidulans (t 0.782 0.426 0.521 2e-31
UNIPROTKB|A4R606 300 MGG_10368 "Putative heme-bindi 0.788 0.446 0.525 4.2e-31
UNIPROTKB|A4QVH4 362 CCP1 "Cytochrome c peroxidase, 0.923 0.433 0.445 1.1e-30
TAIR|locus:2137435 372 SAPX "stromal ascorbate peroxi 0.876 0.400 0.452 3.8e-30
TAIR|locus:2026616 APX1 "ascorbate peroxidase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 716 (257.1 bits), Expect = 9.9e-71, P = 9.9e-71
 Identities = 130/165 (78%), Positives = 148/165 (89%)

Query:     1 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM 60
             MTKNYPTVSEDYKKAVEKC+RKLRG IAEKNCAP+M+R+AWHSAGT+D +++TGGPFGTM
Sbjct:     1 MTKNYPTVSEDYKKAVEKCRRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTM 60

Query:    61 RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD 120
             R  AEQAH AN+G+ IA+RLL+P +EQFPTIS+AD +QLAGVV VEVTGGPDIPFHPGR+
Sbjct:    61 RFDAEQAHGANSGIHIALRLLDPIREQFPTISFADFHQLAGVVAVEVTGGPDIPFHPGRE 120

Query:   121 DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTL 165
             DK +PP EGRLPDA +G DHLR VF  QMGLSDKDIVALSG HTL
Sbjct:   121 DKPQPPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTL 165
GO:0004601 "peroxidase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0006979 "response to oxidative stress" evidence=IEA
GO:0016688 "L-ascorbate peroxidase activity" evidence=ISS;IMP;TAS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0000302 "response to reactive oxygen species" evidence=IMP
GO:0042744 "hydrogen peroxide catabolic process" evidence=IMP
GO:0009793 "embryo development ending in seed dormancy" evidence=IMP
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005618 "cell wall" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009651 "response to salt stress" evidence=IEP;RCA
GO:0009507 "chloroplast" evidence=IDA
GO:0005829 "cytosol" evidence=IDA;TAS
GO:0009506 "plasmodesma" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0006096 "glycolysis" evidence=RCA
GO:0006457 "protein folding" evidence=RCA
GO:0006499 "N-terminal protein myristoylation" evidence=RCA
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0006598 "polyamine catabolic process" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009408 "response to heat" evidence=IEP;RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0009698 "phenylpropanoid metabolic process" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042398 "cellular modified amino acid biosynthetic process" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
TAIR|locus:2074914 APX2 "ascorbate peroxidase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131586 APX3 "ascorbate peroxidase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125409 APX5 "ascorbate peroxidase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000044163 ccp1 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2204735 TAPX "thylakoidal ascorbate peroxidase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000029968 AN5440 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|A4R606 MGG_10368 "Putative heme-binding peroxidase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|A4QVH4 CCP1 "Cytochrome c peroxidase, mitochondrial" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TAIR|locus:2137435 SAPX "stromal ascorbate peroxidase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q05431APX1_ARATH1, ., 1, 1, ., 1, ., 1, 10.78780.97050.66yesno
Q9FE01APX2_ORYSJ1, ., 1, 1, ., 1, ., 1, 10.77430.96470.6533yesno
A2XFC7APX1_ORYSI1, ., 1, 1, ., 1, ., 1, 10.75750.97050.66N/Ano
P48534APX1_PEA1, ., 1, 1, ., 1, ., 1, 10.77380.98820.672N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.11.10.963
4th Layer1.11.1.110.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query170
PLN02364250 PLN02364, PLN02364, L-ascorbate peroxidase 1 8e-98
cd00691253 cd00691, ascorbate_peroxidase, Ascorbate peroxidas 3e-92
PLN02879251 PLN02879, PLN02879, L-ascorbate peroxidase 1e-89
PLN02608 289 PLN02608, PLN02608, L-ascorbate peroxidase 4e-87
pfam00141180 pfam00141, peroxidase, Peroxidase 6e-43
cd00314255 cd00314, plant_peroxidase_like, Heme-dependent per 1e-35
COG0376 730 COG0376, KatG, Catalase (peroxidase I) [Inorganic 2e-26
cd00649 409 cd00649, catalase_peroxidase_1, N-terminal catalyt 2e-16
TIGR00198 716 TIGR00198, cat_per_HPI, catalase/peroxidase HPI 1e-15
cd08201264 cd08201, plant_peroxidase_like_1, Uncharacterized 5e-15
cd00692 328 cd00692, ligninase, Ligninase and other manganese- 5e-12
PRK15061 726 PRK15061, PRK15061, catalase/hydroperoxidase HPI(I 9e-12
cd00693 298 cd00693, secretory_peroxidase, Horseradish peroxid 3e-08
COG0376 730 COG0376, KatG, Catalase (peroxidase I) [Inorganic 1e-06
cd08200 297 cd08200, catalase_peroxidase_2, C-terminal non-cat 5e-06
PRK15061 726 PRK15061, PRK15061, catalase/hydroperoxidase HPI(I 3e-05
PLN03030 324 PLN03030, PLN03030, cationic peroxidase; Provision 1e-04
TIGR00198 716 TIGR00198, cat_per_HPI, catalase/peroxidase HPI 4e-04
>gnl|CDD|166005 PLN02364, PLN02364, L-ascorbate peroxidase 1 Back     alignment and domain information 
 Score =  282 bits (722), Expect = 8e-98
 Identities = 130/165 (78%), Positives = 148/165 (89%)

Query: 1   MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTM 60
           MTKNYPTVSEDYKKAVEKC+RKLRG IAEKNCAP+M+R+AWHSAGT+D +++TGGPFGTM
Sbjct: 1   MTKNYPTVSEDYKKAVEKCRRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTM 60

Query: 61  RLAAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRD 120
           R  AEQAH AN+G+ IA+RLL+P +EQFPTIS+AD +QLAGVV VEVTGGPDIPFHPGR+
Sbjct: 61  RFDAEQAHGANSGIHIALRLLDPIREQFPTISFADFHQLAGVVAVEVTGGPDIPFHPGRE 120

Query: 121 DKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTL 165
           DK +PP EGRLPDA +G DHLR VF  QMGLSDKDIVALSG HTL
Sbjct: 121 DKPQPPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTL 165

Length = 250
>gnl|CDD|173825 cd00691, ascorbate_peroxidase, Ascorbate peroxidases and cytochrome C peroxidases Back     alignment and domain information
>gnl|CDD|178467 PLN02879, PLN02879, L-ascorbate peroxidase Back     alignment and domain information
>gnl|CDD|178218 PLN02608, PLN02608, L-ascorbate peroxidase Back     alignment and domain information
>gnl|CDD|215745 pfam00141, peroxidase, Peroxidase Back     alignment and domain information
>gnl|CDD|173823 cd00314, plant_peroxidase_like, Heme-dependent peroxidases similar to plant peroxidases Back     alignment and domain information
>gnl|CDD|223453 COG0376, KatG, Catalase (peroxidase I) [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|173824 cd00649, catalase_peroxidase_1, N-terminal catalytic domain of catalase-peroxidases Back     alignment and domain information
>gnl|CDD|232870 TIGR00198, cat_per_HPI, catalase/peroxidase HPI Back     alignment and domain information
>gnl|CDD|173829 cd08201, plant_peroxidase_like_1, Uncharacterized family of plant peroxidase-like proteins Back     alignment and domain information
>gnl|CDD|173826 cd00692, ligninase, Ligninase and other manganese-dependent fungal peroxidases Back     alignment and domain information
>gnl|CDD|237891 PRK15061, PRK15061, catalase/hydroperoxidase HPI(I); Provisional Back     alignment and domain information
>gnl|CDD|173827 cd00693, secretory_peroxidase, Horseradish peroxidase and related secretory plant peroxidases Back     alignment and domain information
>gnl|CDD|223453 COG0376, KatG, Catalase (peroxidase I) [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|173828 cd08200, catalase_peroxidase_2, C-terminal non-catalytic domain of catalase-peroxidases Back     alignment and domain information
>gnl|CDD|237891 PRK15061, PRK15061, catalase/hydroperoxidase HPI(I); Provisional Back     alignment and domain information
>gnl|CDD|215545 PLN03030, PLN03030, cationic peroxidase; Provisional Back     alignment and domain information
>gnl|CDD|232870 TIGR00198, cat_per_HPI, catalase/peroxidase HPI Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 170
PLN02364250 L-ascorbate peroxidase 1 100.0
PLN02879251 L-ascorbate peroxidase 100.0
PLN02608 289 L-ascorbate peroxidase 100.0
cd00691253 ascorbate_peroxidase Ascorbate peroxidases and cyt 100.0
PLN03030 324 cationic peroxidase; Provisional 100.0
cd00693 298 secretory_peroxidase Horseradish peroxidase and re 100.0
PF00141230 peroxidase: Peroxidase; InterPro: IPR002016 Peroxi 100.0
cd00314255 plant_peroxidase_like Heme-dependent peroxidases s 100.0
cd00692 328 ligninase Ligninase and other manganese-dependent 100.0
cd00649 409 catalase_peroxidase_1 N-terminal catalytic domain 100.0
cd08201264 plant_peroxidase_like_1 Uncharacterized family of 100.0
TIGR00198 716 cat_per_HPI catalase/peroxidase HPI. Note that the 100.0
PRK15061 726 catalase/hydroperoxidase HPI(I); Provisional 100.0
cd08200297 catalase_peroxidase_2 C-terminal non-catalytic dom 100.0
TIGR00198 716 cat_per_HPI catalase/peroxidase HPI. Note that the 100.0
PRK15061 726 catalase/hydroperoxidase HPI(I); Provisional 99.97
COG0376 730 KatG Catalase (peroxidase I) [Inorganic ion transp 99.96
COG0376 730 KatG Catalase (peroxidase I) [Inorganic ion transp 99.58
>PLN02364 L-ascorbate peroxidase 1 Back     alignment and domain information 
Probab=100.00  E-value=9.6e-57  Score=370.27  Aligned_cols=169  Identities=77%  Similarity=1.275  Sum_probs=165.2

Q ss_pred             CCCCCCChhHHHHHHHHHHHHHhhhhhhcCCchHHHHHHHhhhccccCCCCCCCCCCCccccHHHhhccCcCchHHHHHH
Q 030837            1 MTKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRL   80 (170)
Q Consensus         1 ~~~~cp~~~~~v~~~v~~~~~~l~~~~~~~~~a~~~lRL~fHDc~~~d~s~~~gG~dgsi~~~~E~~~~~N~gl~~~~~~   80 (170)
                      |.|.||.+.+.+++++++++++|++++.|+.++|.+|||+||||++||.....|||||||++.+|+++++|.+|.+++++
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~lRl~FHd~~t~dc~~~~GG~dgSi~~~~E~~~~~N~gl~~~~~~   80 (250)
T PLN02364          1 MTKNYPTVSEDYKKAVEKCRRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTMRFDAEQAHGANSGIHIALRL   80 (250)
T ss_pred             CCCCCCCccHHHHHHHHHHHHHHHHHHhCCCcHHHHHHHHHccccCcCcCCCCCCCCccccccccccCCCccCHHHHHHH
Confidence            88999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhHHhhCCCCcHHHHHHHHhhhHhhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHh-cCCChhhHHHh
Q 030837           81 LEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQ-MGLSDKDIVAL  159 (170)
Q Consensus        81 i~~iK~~~~~VS~ADiialAa~~av~~~GgP~~~v~~GR~D~~~s~~~~~lP~p~~~~~~l~~~F~~~-~Gl~~~e~VaL  159 (170)
                      |++||+++++|||||||+||+++||+++|||.|+|++||+|++++.++++||.|+.+++++++.| +. +|||++|||+|
T Consensus        81 i~~ik~~~~~VScADilalAardAV~~~GGP~~~v~~GR~D~~~s~~~~~lP~p~~~~~~l~~~F-~~~~Gl~~~d~VaL  159 (250)
T PLN02364         81 LDPIREQFPTISFADFHQLAGVVAVEVTGGPDIPFHPGREDKPQPPPEGRLPDATKGCDHLRDVF-AKQMGLSDKDIVAL  159 (250)
T ss_pred             HHHHHHHcCCcCHHHHHHHHHHHHHHhcCCCeeCCCCCCCCcccccccCCCCCCCcCHHHHHHHH-HHhcCCCHHHheee
Confidence            99999999999999999999999999999999999999999999988889999999999999999 75 69999999999


Q ss_pred             hccccccccCC
Q 030837          160 SGGHTLVSAKL  170 (170)
Q Consensus       160 ~GaHtiG~~hc  170 (170)
                      +||||||++||
T Consensus       160 sGaHTiG~~hc  170 (250)
T PLN02364        160 SGAHTLGRCHK  170 (250)
T ss_pred             ecceeeccccC
Confidence            99999999999

>PLN02879 L-ascorbate peroxidase Back     alignment and domain information
>PLN02608 L-ascorbate peroxidase Back     alignment and domain information
>cd00691 ascorbate_peroxidase Ascorbate peroxidases and cytochrome C peroxidases Back     alignment and domain information
>PLN03030 cationic peroxidase; Provisional Back     alignment and domain information
>cd00693 secretory_peroxidase Horseradish peroxidase and related secretory plant peroxidases Back     alignment and domain information
>PF00141 peroxidase: Peroxidase; InterPro: IPR002016 Peroxidases are haem-containing enzymes that use hydrogen peroxide as the electron acceptor to catalyse a number of oxidative reactions Back     alignment and domain information
>cd00314 plant_peroxidase_like Heme-dependent peroxidases similar to plant peroxidases Back     alignment and domain information
>cd00692 ligninase Ligninase and other manganese-dependent fungal peroxidases Back     alignment and domain information
>cd00649 catalase_peroxidase_1 N-terminal catalytic domain of catalase-peroxidases Back     alignment and domain information
>cd08201 plant_peroxidase_like_1 Uncharacterized family of plant peroxidase-like proteins Back     alignment and domain information
>TIGR00198 cat_per_HPI catalase/peroxidase HPI Back     alignment and domain information
>PRK15061 catalase/hydroperoxidase HPI(I); Provisional Back     alignment and domain information
>cd08200 catalase_peroxidase_2 C-terminal non-catalytic domain of catalase-peroxidases Back     alignment and domain information
>TIGR00198 cat_per_HPI catalase/peroxidase HPI Back     alignment and domain information
>PRK15061 catalase/hydroperoxidase HPI(I); Provisional Back     alignment and domain information
>COG0376 KatG Catalase (peroxidase I) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0376 KatG Catalase (peroxidase I) [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query170
1apx_A249 Crystal Structure Of Recombinant Ascorbate Peroxida 7e-76
2cl4_X261 Ascorbate Peroxidase R172a Mutant Length = 261 2e-74
1oaf_A261 Ascobate Peroxidase From Soybean Cytosol In Complex 2e-74
2xif_A249 The Structure Of Ascorbate Peroxidase Compound Ii L 2e-74
2vcf_X264 Structure Of Isoniazid (Inh) Bound To Cytosolic Soy 2e-74
2y6b_A249 Ascorbate Peroxidase R38k Mutant Length = 249 5e-74
2y6a_A249 Ascorbate Peroxidase R38a Mutant Length = 249 1e-73
2vcs_A261 Structure Of Isoniazid (Inh) Bound To Cytosolic Soy 2e-73
2ggn_X261 Conformational Mobility In The Active Site Of A Hem 6e-73
3zcy_A249 Ascorbate Peroxidase W41a-h42y Mutant Length = 249 3e-72
3zch_A261 Ascorbate Peroxidase W41a-h42m Mutant Length = 261 6e-72
3zcg_A261 Ascorbate Peroxidase W41a-h42c Mutant Length = 261 1e-71
1iyn_A 295 Crystal Structure Of Chloroplastic Ascorbate Peroxi 1e-31
3e2n_A 287 Engineering Ascorbate Peroxidase Activity Into Cyto 3e-29
1stq_A 294 Cyrstal Structure Of Cytochrome C Peroxidase Mutant 9e-28
1krj_A 294 Engineering Calcium-Binding Site Into Cytochrome C 4e-27
1sog_A 294 Cyrstal Structure Of Cytochrome C Peroxidase Mutant 4e-27
1jci_A 294 Stabilization Of The Engineered Cation-Binding Loop 4e-27
1jdr_A 294 Crystal Structure Of A Proximal Domain Potassium Bi 4e-27
3riv_A 271 The Crystal Structure Of Leishmania Major Peroxidas 1e-26
3riw_A 271 The Crystal Structure Of Leishmania Major Peroxidas 1e-26
1s6v_A 294 Structure Of A Cytochrome C Peroxidase-Cytochrome C 1e-26
4ged_A 268 Crystal Structure Of The Leishmania Major Peroxidas 1e-26
2v23_A 296 Structure Of Cytochrome C Peroxidase Mutant N184r Y 1e-26
2v2e_A 294 Structure Of Isoniazid (Inh) Bound To Cytochrome C 1e-26
4a71_A 296 Cytochrome C Peroxidase In Complex With Phenol Leng 1e-26
4a78_A 296 Cytochrome C Peroxidase M119w In Complex With Guiac 1e-26
1kok_A 294 Crystal Structure Of Mesopone Cytochrome C Peroxida 2e-26
1ebe_A 294 Laue Diffraction Study On The Structure Of Cytochro 2e-26
2xil_A 294 The Structure Of Cytochrome C Peroxidase Compound I 2e-26
3m23_A 291 Crystallographic And Single Crystal Spectral Analys 2e-26
3e2o_A 294 Crystal Structure Of Cytochrome C Peroxidase, N184r 2e-26
2x07_A 293 Cytochrome C Peroxidase: Engineered Ascorbate Bindi 2e-26
2xj5_A 294 The Structure Of Cytochrome C Peroxidase Compound I 2e-26
3r98_A 293 Joint Neutron And X-Ray Structure Of Cytochrome C P 2e-26
4a7m_A 296 Cytochrome C Peroxidase S81w Mutant Length = 296 3e-26
1mk8_A 294 Crystal Structure Of A Mutant Cytochrome C Peroxida 7e-26
1cyf_A 296 Identifying The Physiological Electron Transfer Sit 3e-25
1bek_A 291 Effect Of Unnatural Heme Substitution On Kinetics O 3e-25
1a2f_A 291 Probing The Strength And Character Of An Asp-His-X 3e-25
3exb_A 295 Crystal Structure Of Cytochrome C Peroxidase With A 4e-25
1cci_A 294 How Flexible Are Proteins? Trapping Of A Flexible L 4e-25
2gb8_A 294 Solution Structure Of The Complex Between Yeast Iso 4e-25
1cmu_A 294 The Role Of Aspartate-235 In The Binding Of Cations 4e-25
2aqd_A 294 Cytochrome C Peroxidase (Ccp) In Complex With 2,5- 4e-25
1dcc_A 296 2.2 Angstrom Structure Of Oxyperoxidase: A Model Fo 4e-25
2cep_A 296 Role Of Met-230 In Intramolecular Electron Transfer 4e-25
1cca_A 297 The Asp-His-Fe Triad Of Cytochrome C Peroxidase Con 4e-25
2pcb_A 296 Crystal Structure Of A Complex Between Electron Tra 4e-25
1ccc_A 297 The Asp-His-Fe Triad Of Cytochrome C Peroxidase Con 4e-25
2ccp_A 296 X-Ray Structures Of Recombinant Yeast Cytochrome C 4e-25
1beq_A 291 Interaction Between Proximal And Distals Regions Of 4e-25
1ccb_A 297 The Asp-His-Fe Triad Of Cytochrome C Peroxidase Con 4e-25
2anz_A 294 Cytochrome C Peroxidase In Complex With 2,6-Diamino 4e-25
1cpg_A 296 A Cation Binding Motif Stabilizes The Compound I Ra 4e-25
1bep_A 291 Effect Of Unnatural Heme Substitution On Kinetics O 4e-25
1ccl_A 291 Probing The Strength And Character Of An Asp-His-X 5e-25
1a2g_A 291 Probing The Strength And Character Of An Asp-His-X 5e-25
1cpd_A 296 A Cation Binding Motif Stabilizes The Compound I Ra 5e-25
1cck_A 291 Altering Substrate Specificity Of Cytochrome C Pero 5e-25
2rbu_X 292 Cytochrome C Peroxidase In Complex With Cyclopentan 5e-25
1kxn_A 289 Crystal Structure Of Cytochrome C Peroxidase With A 5e-25
1bem_A 291 Interaction Between Proximal And Distals Regions Of 5e-25
1kxm_A 290 Crystal Structure Of Cytochrome C Peroxidase With A 5e-25
1bej_A 291 Interaction Between Proximal And Distals Regions Of 5e-25
2ia8_A 291 Kinetic And Crystallographic Studies Of A Redesigne 5e-25
6ccp_A 296 Effect Of Arginine-48 Replacement On The Reaction B 1e-24
4ccx_A 294 Altering Substrate Specificity At The Heme Edge Of 1e-24
3ccx_A 294 Altering Substrate Specificity At The Heme Edge Of 2e-24
1dj1_A 291 Crystal Structure Of R48a Mutant Of Cytochrome C Pe 3e-24
7ccp_A 296 Effect Of Arginine-48 Replacement On The Reaction B 3e-24
1ds4_A 292 Cytochrome C Peroxidase H175g Mutant, Imidazole Com 6e-24
5ccp_A 296 Histidine 52 Is A Critical Residue For Rapid Format 7e-24
1bva_A 294 Manganese Binding Mutant In Cytochrome C Peroxidase 7e-24
1cce_A 291 Construction Of A Bis-Aquo Heme Enzyme And Replacem 8e-24
4ccp_A 296 X-Ray Structures Of Recombinant Yeast Cytochrome C 8e-24
1dse_A 292 Cytochrome C Peroxidase H175g Mutant, Imidazole Com 2e-23
2dv1_A 748 Crystal Structure Of D141e Mutant Of Bpkatg Length 7e-11
1x7u_A 748 Crystal Structure Of The S324t Of Catalase-Peroxida 9e-11
1mwv_A 714 Crystal Structure Of Catalase-peroxidase Katg Of Bu 9e-11
3n3q_A 748 Crystal Structure Of The S324t Variant Of Burkholde 9e-11
2fxg_A 748 Crystal Structure Of Katg At Ph 4.5 Length = 748 9e-11
3n3s_A 748 Crystal Structure Of The E198a Variant Of Burkholde 9e-11
1ub2_A 720 Crystal Structure Of Catalase-Peroxidase From Synec 2e-10
1mn1_A 357 Manganese Peroxidase Substrate Binding Site Mutant 4e-10
1mn2_A 357 Manganese Peroxidase Substrate Binding Site Mutant 4e-10
1yyd_A 357 High Resolution Crystal Structure Of Manganese Pero 5e-10
3rrw_A268 Crystal Structure Of The Tl29 Protein From Arabidop 1e-09
3vlh_A 737 Crystal Structure Analysis Of The Arg409leu Variant 2e-09
1itk_A 731 Crystal Structure Of Catalase-peroxidase From Haloa 2e-09
3vlk_A 737 Crystal Structure Analysis Of The Ser305ala Variant 2e-09
3uw8_A 737 Crystal Structure Analysis Of The Ser305thr Variant 2e-09
2dv2_A 748 Crystal Structure Of D141e Mutant Of Bpkatg At Ph 8 4e-09
3n3r_A 748 Crystal Structure Of The E198a Variant Of Catalase- 5e-09
2fxj_A 748 Crystal Structure Of Katg At Ph 8.5 Length = 748 5e-09
3vlm_A 737 Crystal Structure Analysis Of The Met244ala Variant 5e-09
2cca_A 740 Crystal Structure Of The Catalase-Peroxidase (Katg) 8e-07
2ccd_A 740 Crystal Structure Of The Catalase-Peroxidase (Katg) 8e-07
1sj2_A 743 Crystal Structure Of Mycobacterium Tuberculosis Cat 8e-07
3fm6_A 331 Crystal Structure Analysis Of Fungal Versatile Pero 2e-06
4fef_A 315 The Crystal Structures Of Several Mutants Of Pleuro 4e-06
3q3u_A 338 Trametes Cervina Lignin Peroxidase Length = 338 5e-06
4a5g_A 308 Raphanus Sativus Anionic Peroxidase. Length = 308 6e-06
3ut2_A 764 Crystal Structure Of Fungal Magkatg2 Length = 764 2e-05
1u2k_A 309 Crystal Structure Of The C-Terminal Domain From The 6e-05
1u2j_A 326 Crystal Structure Of The C-Terminal Domain From The 6e-05
1fhf_A 304 The Structure Of Soybean Peroxidase Length = 304 4e-04
>pdb|1APX|A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase Length = 249 Back     alignment and structure 
Iteration: 1

 Score =  279 bits (713), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 129/166 (77%), Positives = 147/166 (88%)
Query: 3   KNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRL 62
           K+YPTVS DY+KA+EK KRKLRGFIAEK CAPL+LR+AWHSAGT+D KTKTGGPFGT++ 
Sbjct: 2   KSYPTVSPDYQKAIEKAKRKLRGFIAEKKCAPLILRLAWHSAGTFDSKTKTGGPFGTIKH 61
Query: 63  AAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDK 122
            AE AH ANNGLDIAVRLLEP KEQFP +SYAD YQLAGVV VE+TGGP++PFHPGR+DK
Sbjct: 62  QAELAHGANNGLDIAVRLLEPIKEQFPIVSYADFYQLAGVVAVEITGGPEVPFHPGREDK 121
Query: 123 AEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTLVSA 168
            EPP EGRLPDA +G+DHLR VFG  MGLSD+DIVALSGGHT+ +A
Sbjct: 122 PEPPPEGRLPDATKGSDHLRDVFGKAMGLSDQDIVALSGGHTIGAA 167
>pdb|2CL4|X Chain X, Ascorbate Peroxidase R172a Mutant Length = 261 Back     alignment and structure
>pdb|1OAF|A Chain A, Ascobate Peroxidase From Soybean Cytosol In Complex With Ascorbate Length = 261 Back     alignment and structure
>pdb|2XIF|A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii Length = 249 Back     alignment and structure
>pdb|2VCF|X Chain X, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase Length = 264 Back     alignment and structure
>pdb|2Y6B|A Chain A, Ascorbate Peroxidase R38k Mutant Length = 249 Back     alignment and structure
>pdb|2Y6A|A Chain A, Ascorbate Peroxidase R38a Mutant Length = 249 Back     alignment and structure
>pdb|2VCS|A Chain A, Structure Of Isoniazid (Inh) Bound To Cytosolic Soybean Ascorbate Peroxidase Mutant H42a Length = 261 Back     alignment and structure
>pdb|2GGN|X Chain X, Conformational Mobility In The Active Site Of A Heme Peroxidase Length = 261 Back     alignment and structure
>pdb|3ZCY|A Chain A, Ascorbate Peroxidase W41a-h42y Mutant Length = 249 Back     alignment and structure
>pdb|3ZCH|A Chain A, Ascorbate Peroxidase W41a-h42m Mutant Length = 261 Back     alignment and structure
>pdb|3ZCG|A Chain A, Ascorbate Peroxidase W41a-h42c Mutant Length = 261 Back     alignment and structure
>pdb|1IYN|A Chain A, Crystal Structure Of Chloroplastic Ascorbate Peroxidase From Tobacco Plants And Structural Insights For Its Instability Length = 295 Back     alignment and structure
>pdb|3E2N|A Chain A, Engineering Ascorbate Peroxidase Activity Into Cytochrome C Peroxidase Length = 287 Back     alignment and structure
>pdb|1STQ|A Chain A, Cyrstal Structure Of Cytochrome C Peroxidase Mutant: Ccpk2m3 Length = 294 Back     alignment and structure
>pdb|1KRJ|A Chain A, Engineering Calcium-Binding Site Into Cytochrome C Peroxidase (Ccp) Length = 294 Back     alignment and structure
>pdb|1SOG|A Chain A, Cyrstal Structure Of Cytochrome C Peroxidase Mutant: Ccpk2m2 Length = 294 Back     alignment and structure
>pdb|1JCI|A Chain A, Stabilization Of The Engineered Cation-Binding Loop In Cytochrome C Peroxidase (Ccp) Length = 294 Back     alignment and structure
>pdb|1JDR|A Chain A, Crystal Structure Of A Proximal Domain Potassium Binding Variant Of Cytochrome C Peroxidase Length = 294 Back     alignment and structure
>pdb|3RIV|A Chain A, The Crystal Structure Of Leishmania Major Peroxidase Length = 271 Back     alignment and structure
>pdb|3RIW|A Chain A, The Crystal Structure Of Leishmania Major Peroxidase Mutant C197t Length = 271 Back     alignment and structure
>pdb|1S6V|A Chain A, Structure Of A Cytochrome C Peroxidase-Cytochrome C Site Specific Cross-Link Length = 294 Back     alignment and structure
>pdb|4GED|A Chain A, Crystal Structure Of The Leishmania Major Peroxidase-Cytochrome C Complex Length = 268 Back     alignment and structure
>pdb|2V23|A Chain A, Structure Of Cytochrome C Peroxidase Mutant N184r Y36a Length = 296 Back     alignment and structure
>pdb|2V2E|A Chain A, Structure Of Isoniazid (Inh) Bound To Cytochrome C Peroxidase Mutant N184r Y36a Length = 294 Back     alignment and structure
>pdb|4A71|A Chain A, Cytochrome C Peroxidase In Complex With Phenol Length = 296 Back     alignment and structure
>pdb|4A78|A Chain A, Cytochrome C Peroxidase M119w In Complex With Guiacol Length = 296 Back     alignment and structure
>pdb|1KOK|A Chain A, Crystal Structure Of Mesopone Cytochrome C Peroxidase (Mpccp) Length = 294 Back     alignment and structure
>pdb|1EBE|A Chain A, Laue Diffraction Study On The Structure Of Cytochrome C Peroxidase Compound I Length = 294 Back     alignment and structure
>pdb|2XIL|A Chain A, The Structure Of Cytochrome C Peroxidase Compound I Length = 294 Back     alignment and structure
>pdb|3M23|A Chain A, Crystallographic And Single Crystal Spectral Analysis Of The Peroxidase Ferryl Intermediate Length = 291 Back     alignment and structure
>pdb|3E2O|A Chain A, Crystal Structure Of Cytochrome C Peroxidase, N184r Mutant Length = 294 Back     alignment and structure
>pdb|2X07|A Chain A, Cytochrome C Peroxidase: Engineered Ascorbate Binding Site Length = 293 Back     alignment and structure
>pdb|2XJ5|A Chain A, The Structure Of Cytochrome C Peroxidase Compound Ii Length = 294 Back     alignment and structure
>pdb|3R98|A Chain A, Joint Neutron And X-Ray Structure Of Cytochrome C Peroxidase Length = 293 Back     alignment and structure
>pdb|4A7M|A Chain A, Cytochrome C Peroxidase S81w Mutant Length = 296 Back     alignment and structure
>pdb|1MK8|A Chain A, Crystal Structure Of A Mutant Cytochrome C Peroxidase Showing A Novel Trp-Tyr Covalent Cross-Link Length = 294 Back     alignment and structure
>pdb|1CYF|A Chain A, Identifying The Physiological Electron Transfer Site Of Cytochrome C Peroxidase By Structure-Based Engineering Length = 296 Back     alignment and structure
>pdb|1BEK|A Chain A, Effect Of Unnatural Heme Substitution On Kinetics Of Electron Transfer In Cytochrome C Peroxidase Length = 291 Back     alignment and structure
>pdb|1A2F|A Chain A, Probing The Strength And Character Of An Asp-His-X Hydrogen Bond By Introducing Buried Charges Length = 291 Back     alignment and structure
>pdb|3EXB|A Chain A, Crystal Structure Of Cytochrome C Peroxidase With A Proposed Electron Pathway Excised In A Complex With A Peptide Wire Length = 295 Back     alignment and structure
>pdb|1CCI|A Chain A, How Flexible Are Proteins? Trapping Of A Flexible Loop Length = 294 Back     alignment and structure
>pdb|2GB8|A Chain A, Solution Structure Of The Complex Between Yeast Iso-1- Cytochrome C And Yeast Cytochrome C Peroxidase Length = 294 Back     alignment and structure
>pdb|1CMU|A Chain A, The Role Of Aspartate-235 In The Binding Of Cations To An Artificial Cavity At The Radical Site Of Cytochrome C Peroxidase Length = 294 Back     alignment and structure
>pdb|2AQD|A Chain A, Cytochrome C Peroxidase (Ccp) In Complex With 2,5- Diaminopyridine Length = 294 Back     alignment and structure
>pdb|1DCC|A Chain A, 2.2 Angstrom Structure Of Oxyperoxidase: A Model For The Enzyme:peroxide Complex Length = 296 Back     alignment and structure
>pdb|2CEP|A Chain A, Role Of Met-230 In Intramolecular Electron Transfer Between The Oxyferryl Heme And Trp 191 In Cytochrome C Peroxidase Compound Ii Length = 296 Back     alignment and structure
>pdb|1CCA|A Chain A, The Asp-His-Fe Triad Of Cytochrome C Peroxidase Controls The Reduction Potential, Electronic Structure, And Coupling Of The Tryptophan Free-Radical To The Heme Length = 297 Back     alignment and structure
>pdb|2PCB|A Chain A, Crystal Structure Of A Complex Between Electron Transfer Partners, Cytochrome C Peroxidase And Cytochrome C Length = 296 Back     alignment and structure
>pdb|1CCC|A Chain A, The Asp-His-Fe Triad Of Cytochrome C Peroxidase Controls The Reduction Potential, Electronic Structure, And Coupling Of The Tryptophan Free-Radical To The Heme Length = 297 Back     alignment and structure
>pdb|2CCP|A Chain A, X-Ray Structures Of Recombinant Yeast Cytochrome C Peroxidase And Three Heme-Cleft Mutants Prepared By Site-Directed Mutagenesis Length = 296 Back     alignment and structure
>pdb|1BEQ|A Chain A, Interaction Between Proximal And Distals Regions Of Cytochrome C Peroxidase Length = 291 Back     alignment and structure
>pdb|1CCB|A Chain A, The Asp-His-Fe Triad Of Cytochrome C Peroxidase Controls The Reduction Potential, Electronic Structure, And Coupling Of The Tryptophan Free-Radical To The Heme Length = 297 Back     alignment and structure
>pdb|2ANZ|A Chain A, Cytochrome C Peroxidase In Complex With 2,6-Diaminopyridine Length = 294 Back     alignment and structure
>pdb|1CPG|A Chain A, A Cation Binding Motif Stabilizes The Compound I Radical Of Cytochrome C Peroxidase Length = 296 Back     alignment and structure
>pdb|1BEP|A Chain A, Effect Of Unnatural Heme Substitution On Kinetics Of Electron Transfer In Cytochrome C Peroxidase Length = 291 Back     alignment and structure
>pdb|1CCL|A Chain A, Probing The Strength And Character Of An Asp-His-X Hydrogen Bond By Introducing Buried Charges Length = 291 Back     alignment and structure
>pdb|1A2G|A Chain A, Probing The Strength And Character Of An Asp-His-X Hydrogen Bond By Introducing Buried Charges Length = 291 Back     alignment and structure
>pdb|1CPD|A Chain A, A Cation Binding Motif Stabilizes The Compound I Radical Of Cytochrome C Peroxidase Length = 296 Back     alignment and structure
>pdb|1CCK|A Chain A, Altering Substrate Specificity Of Cytochrome C Peroxidase Towards A Small Molecular Substrate Peroxidase By Substituting Tyrosine For Phe 202 Length = 291 Back     alignment and structure
>pdb|2RBU|X Chain X, Cytochrome C Peroxidase In Complex With Cyclopentane-Carboximidamide Length = 292 Back     alignment and structure
>pdb|1KXN|A Chain A, Crystal Structure Of Cytochrome C Peroxidase With A Proposed Electron Transfer Pathway Excised To Form A Ligand Binding Channel Length = 289 Back     alignment and structure
>pdb|1BEM|A Chain A, Interaction Between Proximal And Distals Regions Of Cytochrome C Peroxidase Length = 291 Back     alignment and structure
>pdb|1KXM|A Chain A, Crystal Structure Of Cytochrome C Peroxidase With A Proposed Electron Transfer Pathway Excised To Form A Ligand Binding Channel Length = 290 Back     alignment and structure
>pdb|1BEJ|A Chain A, Interaction Between Proximal And Distals Regions Of Cytochrome C Peroxidase Length = 291 Back     alignment and structure
>pdb|2IA8|A Chain A, Kinetic And Crystallographic Studies Of A Redesigned Manganese-Binding Site In Cytochrome C Peroxidase Length = 291 Back     alignment and structure
>pdb|6CCP|A Chain A, Effect Of Arginine-48 Replacement On The Reaction Between Cytochrome C Peroxidase And Hydrogen Peroxide Length = 296 Back     alignment and structure
>pdb|4CCX|A Chain A, Altering Substrate Specificity At The Heme Edge Of Cytochrome C Peroxidase Length = 294 Back     alignment and structure
>pdb|3CCX|A Chain A, Altering Substrate Specificity At The Heme Edge Of Cytochrome C Peroxidase Length = 294 Back     alignment and structure
>pdb|1DJ1|A Chain A, Crystal Structure Of R48a Mutant Of Cytochrome C Peroxidase Length = 291 Back     alignment and structure
>pdb|7CCP|A Chain A, Effect Of Arginine-48 Replacement On The Reaction Between Cytochrome C Peroxidase And Hydrogen Peroxide Length = 296 Back     alignment and structure
>pdb|1DS4|A Chain A, Cytochrome C Peroxidase H175g Mutant, Imidazole Complex, Ph 6, 100k Length = 292 Back     alignment and structure
>pdb|5CCP|A Chain A, Histidine 52 Is A Critical Residue For Rapid Formation Of Cytochrome C Peroxidase Compound I Length = 296 Back     alignment and structure
>pdb|1BVA|A Chain A, Manganese Binding Mutant In Cytochrome C Peroxidase Length = 294 Back     alignment and structure
>pdb|1CCE|A Chain A, Construction Of A Bis-Aquo Heme Enzyme And Replacement With Exogenous Ligand Length = 291 Back     alignment and structure
>pdb|4CCP|A Chain A, X-Ray Structures Of Recombinant Yeast Cytochrome C Peroxidase And Three Heme-Cleft Mutants Prepared By Site-Directed Mutagenesis Length = 296 Back     alignment and structure
>pdb|1DSE|A Chain A, Cytochrome C Peroxidase H175g Mutant, Imidazole Complex, With Phosphate Bound, Ph 6, 100k Length = 292 Back     alignment and structure
>pdb|2DV1|A Chain A, Crystal Structure Of D141e Mutant Of Bpkatg Length = 748 Back     alignment and structure
>pdb|1X7U|A Chain A, Crystal Structure Of The S324t Of Catalase-Peroxidase Katg Length = 748 Back     alignment and structure
>pdb|1MWV|A Chain A, Crystal Structure Of Catalase-peroxidase Katg Of Burkholderia Pseudomallei Length = 714 Back     alignment and structure
>pdb|3N3Q|A Chain A, Crystal Structure Of The S324t Variant Of Burkholderia Pseudomallei Katg With Isonicotinic Acid Hydrazide Bound Length = 748 Back     alignment and structure
>pdb|2FXG|A Chain A, Crystal Structure Of Katg At Ph 4.5 Length = 748 Back     alignment and structure
>pdb|3N3S|A Chain A, Crystal Structure Of The E198a Variant Of Burkholderia Pseudomallei Catalase-Peroxidase Katg With Inh Length = 748 Back     alignment and structure
>pdb|1UB2|A Chain A, Crystal Structure Of Catalase-Peroxidase From Synechococcus Pcc 7942 Length = 720 Back     alignment and structure
>pdb|1MN1|A Chain A, Manganese Peroxidase Substrate Binding Site Mutant D179n Length = 357 Back     alignment and structure
>pdb|1MN2|A Chain A, Manganese Peroxidase Substrate Binding Site Mutant E35q, D179n Length = 357 Back     alignment and structure
>pdb|1YYD|A Chain A, High Resolution Crystal Structure Of Manganese Peroxidase Length = 357 Back     alignment and structure
>pdb|3RRW|A Chain A, Crystal Structure Of The Tl29 Protein From Arabidopsis Thaliana Length = 268 Back     alignment and structure
>pdb|3VLH|A Chain A, Crystal Structure Analysis Of The Arg409leu Variants Of Katg From Haloarcula Marismortui Length = 737 Back     alignment and structure
>pdb|1ITK|A Chain A, Crystal Structure Of Catalase-peroxidase From Haloarcula Marismortui Length = 731 Back     alignment and structure
>pdb|3VLK|A Chain A, Crystal Structure Analysis Of The Ser305ala Variant Of Katg From Haloarcula Marismortui Length = 737 Back     alignment and structure
>pdb|3UW8|A Chain A, Crystal Structure Analysis Of The Ser305thr Variants Of Katg From Haloarcula Marismortui Length = 737 Back     alignment and structure
>pdb|2DV2|A Chain A, Crystal Structure Of D141e Mutant Of Bpkatg At Ph 8.0 Length = 748 Back     alignment and structure
>pdb|3N3R|A Chain A, Crystal Structure Of The E198a Variant Of Catalase-Peroxidase Katg Of Burkholderia Pseudomallei Length = 748 Back     alignment and structure
>pdb|2FXJ|A Chain A, Crystal Structure Of Katg At Ph 8.5 Length = 748 Back     alignment and structure
>pdb|3VLM|A Chain A, Crystal Structure Analysis Of The Met244ala Variant Of Katg From Haloarcula Marismortui Length = 737 Back     alignment and structure
>pdb|2CCA|A Chain A, Crystal Structure Of The Catalase-Peroxidase (Katg) And S315t Mutant From Mycobacterium Tuberculosis Length = 740 Back     alignment and structure
>pdb|2CCD|A Chain A, Crystal Structure Of The Catalase-Peroxidase (Katg) And S315t Mutant From Mycobacterium Tuberculosis Length = 740 Back     alignment and structure
>pdb|1SJ2|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Catalase-Peroxidase Length = 743 Back     alignment and structure
>pdb|3FM6|A Chain A, Crystal Structure Analysis Of Fungal Versatile Peroxidase From Pleurotus Eryngii Length = 331 Back     alignment and structure
>pdb|4FEF|A Chain A, The Crystal Structures Of Several Mutants Of Pleurotus Eryngii Versatile Peroxidase Length = 315 Back     alignment and structure
>pdb|3Q3U|A Chain A, Trametes Cervina Lignin Peroxidase Length = 338 Back     alignment and structure
>pdb|4A5G|A Chain A, Raphanus Sativus Anionic Peroxidase. Length = 308 Back     alignment and structure
>pdb|3UT2|A Chain A, Crystal Structure Of Fungal Magkatg2 Length = 764 Back     alignment and structure
>pdb|1U2K|A Chain A, Crystal Structure Of The C-Terminal Domain From The Catalase- Peroxidase Katg Of Escherichia Coli (I41) Length = 309 Back     alignment and structure
>pdb|1U2J|A Chain A, Crystal Structure Of The C-Terminal Domain From The Catalase-Peroxidase Katg Of Escherichia Coli (P21 21 21) Length = 326 Back     alignment and structure
>pdb|1FHF|A Chain A, The Structure Of Soybean Peroxidase Length = 304 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query170
3riv_A 271 Ascorbate peroxidase; alpha helical bundle, heme p 7e-86
2vcn_A261 Ascorbate peroxidase; INH, APX, isoniazid, oxidore 4e-81
1iyn_A 295 Chloroplastic ascorbate peroxidase; hydrogen perox 1e-76
3e2o_A 294 CCP, cytochrome C peroxidase; cytochrome C peroxid 2e-76
3rrw_A268 Thylakoid lumenal 29 kDa protein, chloroplastic; c 3e-64
3m5q_A 357 Manganese peroxidase 1; heme, Mn(II)-binding site, 3e-58
3fmu_A 331 VersatIle peroxidase VPL2; class II (fungal) perox 4e-55
3q3u_A 338 Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A 9e-51
1llp_A 343 LIP4.15, lignin peroxidase; heme protein, glyco pr 1e-50
2e39_A 344 Peroxidase; heme protein, coordination geometry of 4e-50
1ub2_A 720 Catalase-peroxidase; KATG, cyanobacteria, oxidored 4e-23
1ub2_A 720 Catalase-peroxidase; KATG, cyanobacteria, oxidored 1e-12
1itk_A 731 Catalase-peroxidase; heme protein, oxidoreductase; 1e-22
1itk_A 731 Catalase-peroxidase; heme protein, oxidoreductase; 2e-10
2cca_A 740 Peroxidase/catalase T; oxidoreductase, catalase-pe 1e-21
2cca_A 740 Peroxidase/catalase T; oxidoreductase, catalase-pe 1e-10
3n3r_A 748 Catalase-peroxidase; E198A variant, tuberclosis, i 1e-20
3n3r_A 748 Catalase-peroxidase; E198A variant, tuberclosis, i 1e-08
3ut2_A 764 Catalase-peroxidase 2; KATG, fungal, heme enzyme, 5e-19
3ut2_A 764 Catalase-peroxidase 2; KATG, fungal, heme enzyme, 2e-11
1u2k_A 309 Peroxidase/catalase HPI; KATG, catalase-peroxidase 7e-10
1qgj_A 300 Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A 2e-08
1sch_A 294 PNP, peanut peroxidase, major cationic isozyme; ca 6e-08
1fhf_A 304 SEED coat peroxidase; oxidoreductase; HET: HEM; 2. 1e-07
1bgp_A 309 Barley grain peroxidase; chromoprotein, oxidoreduc 1e-07
1pa2_A 306 Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45 2e-07
3hdl_A 304 Royal PALM TREE peroxidase; glycosylated, oxidored 3e-07
1gwu_A 309 Peroxidase C1A; oxidoreductase, glycoprotein, heme 4e-06
>3riv_A Ascorbate peroxidase; alpha helical bundle, heme peroxidase, oxidoreductase; HET: HEM; 1.76A {Leishmania major} PDB: 3riw_A* Length = 271 Back     alignment and structure
 Score =  252 bits (645), Expect = 7e-86
 Identities = 64/162 (39%), Positives = 92/162 (56%), Gaps = 6/162 (3%)

Query: 9   SEDYKKAVEKCKRKLRGFIAEK-NCAPLMLRIAWHSAGTYDVKTKTGGP-FGTMRLAAEQ 66
           SE+    +   +  +   I+EK    P ++R+AWH A +YD   K G P   +MR   E 
Sbjct: 2   SEEPPFDIRALRADIEDMISEKLELGPSLIRLAWHEAASYDCFKKDGSPNSASMRFKPEC 61

Query: 67  AHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEP- 125
            ++ N GLDI  + LE  K+++P ISYADL+ LA  V +E  GGP IPF  GR D  +  
Sbjct: 62  LYAGNKGLDIPRKALETLKKKYPQISYADLWVLAAYVAIEYMGGPTIPFCWGRVDAKDGS 121

Query: 126 --PQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTL 165
               +GRLPD  +   H+R+VF  ++G +D++ VAL G HT 
Sbjct: 122 VCGPDGRLPDGSKTQSHVREVFR-RLGFNDQETVALIGAHTC 162
>2vcn_A Ascorbate peroxidase; INH, APX, isoniazid, oxidoreductase; HET: HEM ISZ; 1.20A {Glycine max} PDB: 2ggn_X* 2ghd_X* 2ghe_X* 2ghc_X* 2vnx_X* 2vnz_X* 2vo2_X* 2wd4_A* 1oaf_A* 1oag_A* 1v0h_X* 2ghh_X* 2ghk_X* 2vcf_X* 2cl4_X* 2vcs_A* 2xi6_A* 2xif_A* 2xih_A* 2xj6_A* ... Length = 261 Back     alignment and structure
>1iyn_A Chloroplastic ascorbate peroxidase; hydrogen peroxide, tobacco plant, stromal ascorbate peroxidase, oxidoreductase; HET: HEM; 1.60A {Nicotiana tabacum} SCOP: a.93.1.1 Length = 295 Back     alignment and structure
>3e2o_A CCP, cytochrome C peroxidase; cytochrome C peroxidase (CCP), heme, hydrogen peroxide, iron, metal-binding, mitochondrion; HET: HEM; 1.06A {Saccharomyces cerevisiae} PDB: 1z53_A* 1kok_A* 1sbm_A* 1sdq_A* 1s73_A* 1zby_A* 1zbz_A* 2b0z_A* 2b10_A* 2b11_A* 2b12_A* 2cyp_A* 2ycg_A* 2v23_A* 1ebe_A* 3r98_A* 3r99_A* 1mkr_A* 1mk8_A* 1mkq_A* ... Length = 294 Back     alignment and structure
>3rrw_A Thylakoid lumenal 29 kDa protein, chloroplastic; chloroplast thylakoid lumen, plant protein; 2.50A {Arabidopsis thaliana} Length = 268 Back     alignment and structure
>3m5q_A Manganese peroxidase 1; heme, Mn(II)-binding site, Ca(II)-binding site, glycosylation, ultrahigh resolution, calcium; HET: NAG MAN HEM; 0.93A {Phanerochaete chrysosporium} PDB: 1mnp_A* 1yyg_A* 1yzp_A* 1yzr_A* 1yyd_A* 3m8m_A* 1mn1_A* 1mn2_A* Length = 357 Back     alignment and structure
>3fmu_A VersatIle peroxidase VPL2; class II (fungal) peroxidases, protoporphyrin IX, electron T lignin peroxidase, lignin degradation; HET: HEM; 1.04A {Pleurotus eryngii} PDB: 3fjw_A* 2boq_A* 3fm1_A* 3fm4_A* 3fm6_A* 3fkg_A* 2w23_A* 2vka_A* Length = 331 Back     alignment and structure
>3q3u_A Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A {Trametes cervina} Length = 338 Back     alignment and structure
>1llp_A LIP4.15, lignin peroxidase; heme protein, glyco protein,, oxidoreductase; HET: NAG MAN A2G HEM; 1.70A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1lga_A* 1b80_A* 1b82_A* 1b85_A* 1qpa_A* Length = 343 Back     alignment and structure
>2e39_A Peroxidase; heme protein, coordination geometry of heme iron, ARP, perox oxidoreductase; HET: NAG MAN HEM; 1.30A {'arthromyces ramosus'} SCOP: a.93.1.1 PDB: 1arp_A* 1arv_A* 1arw_A* 1arx_A* 1ary_A* 1c8i_A* 1ck6_A* 1gza_A* 1gzb_A* 1hsr_A* 1aru_A* 2e3a_A* 2e3b_A* 1lyk_A* 1lyc_A* 1ly9_A* 1h3j_A* 1ly8_A* Length = 344 Back     alignment and structure
>1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 Length = 720 Back     alignment and structure
>1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 Length = 720 Back     alignment and structure
>1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 Length = 731 Back     alignment and structure
>1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 Length = 731 Back     alignment and structure
>2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* Length = 740 Back     alignment and structure
>2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* Length = 740 Back     alignment and structure
>3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* Length = 748 Back     alignment and structure
>3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* Length = 748 Back     alignment and structure
>3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} Length = 764 Back     alignment and structure
>3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} Length = 764 Back     alignment and structure
>1u2k_A Peroxidase/catalase HPI; KATG, catalase-peroxidase, C-terminal domain, oxidoreductase; 2.00A {Escherichia coli} SCOP: a.93.1.3 PDB: 1u2l_A 1u2j_A Length = 309 Back     alignment and structure
>1qgj_A Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A {Arabidopsis thaliana} SCOP: a.93.1.1 Length = 300 Back     alignment and structure
>1sch_A PNP, peanut peroxidase, major cationic isozyme; calcium binding, glycosylation, oxidoreductase; HET: NAG HEM; 2.56A {Arachis hypogaea} SCOP: a.93.1.1 Length = 294 Back     alignment and structure
>1fhf_A SEED coat peroxidase; oxidoreductase; HET: HEM; 2.80A {Glycine max} SCOP: a.93.1.1 Length = 304 Back     alignment and structure
>1bgp_A Barley grain peroxidase; chromoprotein, oxidoreductase; HET: HEM; 1.90A {Hordeum vulgare} SCOP: a.93.1.1 Length = 309 Back     alignment and structure
>1pa2_A Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45A {Arabidopsis thaliana} SCOP: a.93.1.1 PDB: 1qo4_A* Length = 306 Back     alignment and structure
>3hdl_A Royal PALM TREE peroxidase; glycosylated, oxidoreductase; HET: HEM MES NAG FUC MAN; 1.85A {Roystonea regia} Length = 304 Back     alignment and structure
>1gwu_A Peroxidase C1A; oxidoreductase, glycoprotein, heme, multigene family, signal,; HET: HEM; 1.31A {Armoracia rusticana} SCOP: a.93.1.1 PDB: 1w4w_A* 1w4y_A* 1gwo_A* 2atj_A* 1gwt_A* 3atj_A* 1gx2_A* 7atj_A* 1h55_A* 1h58_A* 1h5a_A* 1h5c_A* 1h5d_A* 1h5e_A* 1h5f_A* 1h57_A* 1h5h_A* 1h5i_A* 1h5j_A* 1h5k_A* ... Length = 309 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query170
2vcn_A261 Ascorbate peroxidase; INH, APX, isoniazid, oxidore 100.0
1qgj_A 300 Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A 100.0
3hdl_A 304 Royal PALM TREE peroxidase; glycosylated, oxidored 100.0
1fhf_A 304 SEED coat peroxidase; oxidoreductase; HET: HEM; 2. 100.0
1sch_A 294 PNP, peanut peroxidase, major cationic isozyme; ca 100.0
1gwu_A 309 Peroxidase C1A; oxidoreductase, glycoprotein, heme 100.0
1pa2_A 306 Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45 100.0
1iyn_A 295 Chloroplastic ascorbate peroxidase; hydrogen perox 100.0
1bgp_A 309 Barley grain peroxidase; chromoprotein, oxidoreduc 100.0
3e2o_A 294 CCP, cytochrome C peroxidase; cytochrome C peroxid 100.0
3riv_A 271 Ascorbate peroxidase; alpha helical bundle, heme p 100.0
1ub2_A 720 Catalase-peroxidase; KATG, cyanobacteria, oxidored 100.0
2cca_A 740 Peroxidase/catalase T; oxidoreductase, catalase-pe 100.0
1u2k_A 309 Peroxidase/catalase HPI; KATG, catalase-peroxidase 100.0
1itk_A 731 Catalase-peroxidase; heme protein, oxidoreductase; 100.0
3fmu_A 331 VersatIle peroxidase VPL2; class II (fungal) perox 100.0
3q3u_A 338 Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A 100.0
3rrw_A268 Thylakoid lumenal 29 kDa protein, chloroplastic; c 100.0
3m5q_A 357 Manganese peroxidase 1; heme, Mn(II)-binding site, 100.0
2e39_A 344 Peroxidase; heme protein, coordination geometry of 100.0
3vli_A 737 Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1 100.0
1llp_A 343 LIP4.15, lignin peroxidase; heme protein, glyco pr 100.0
3ut2_A 764 Catalase-peroxidase 2; KATG, fungal, heme enzyme, 100.0
3n3r_A 748 Catalase-peroxidase; E198A variant, tuberclosis, i 100.0
1itk_A 731 Catalase-peroxidase; heme protein, oxidoreductase; 100.0
2cca_A 740 Peroxidase/catalase T; oxidoreductase, catalase-pe 100.0
1ub2_A720 Catalase-peroxidase; KATG, cyanobacteria, oxidored 100.0
3vli_A 737 Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1 100.0
3n3r_A 748 Catalase-peroxidase; E198A variant, tuberclosis, i 100.0
3ut2_A 764 Catalase-peroxidase 2; KATG, fungal, heme enzyme, 100.0
>2vcn_A Ascorbate peroxidase; INH, APX, isoniazid, oxidoreductase; HET: HEM ISZ; 1.20A {Glycine max} PDB: 2ggn_X* 2ghd_X* 2ghe_X* 2ghc_X* 2vnx_X* 2vnz_X* 2vo2_X* 2wd4_A* 1oaf_A* 1oag_A* 1v0h_X* 2ghh_X* 2ghk_X* 2vcf_X* 2cl4_X* 2vcs_A* 2xi6_A* 2xif_A* 2xih_A* 2xj6_A* ... Back     alignment and structure
Probab=100.00  E-value=4.9e-57  Score=372.80  Aligned_cols=169  Identities=75%  Similarity=1.220  Sum_probs=162.8

Q ss_pred             CCCCCChhHHHHHHHHHHHHHhhhhhhcCCchHHHHHHHhhhccccCCCCCCCCCCCccccHHHhhccCcCchHHHHHHH
Q 030837            2 TKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLL   81 (170)
Q Consensus         2 ~~~cp~~~~~v~~~v~~~~~~l~~~~~~~~~a~~~lRL~fHDc~~~d~s~~~gG~dgsi~~~~E~~~~~N~gl~~~~~~i   81 (170)
                      .|+.|..+..|+++++++|++|+++++|++++|++|||+|||||+||+|+++||+||||++.+|+++++|.+|.++|++|
T Consensus        13 ~~~~~~~~~~y~~~~~~~r~~v~~~~~d~~~aa~llRL~FHDc~gcD~s~~~gg~~gsi~~~~E~~~~~N~~l~~g~~~i   92 (261)
T 2vcn_A           13 GKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAAHSAGTFDKGTKTGGPFGTIKHPAELAHSANNGLDIAVRLL   92 (261)
T ss_dssp             CCCCCCCCHHHHHC-CHHHHHHHHHHHHHTCHHHHHHHHHHHHTTCBTTTTBCSSSSGGGSHHHHTSGGGTTHHHHHHHH
T ss_pred             CCcCCCCcHHHHHHHHHHHHHHHHHHhCCCchHHHHHHHHccCCCCCcccCCCCCCccccchhhccCccccCHHHHHHHH
Confidence            36889999999999999999999999999999999999999999999999999999999999999999999998999999


Q ss_pred             HhHHhhCCCCcHHHHHHHHhhhHhhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHhcCCChhhHHHhhc
Q 030837           82 EPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSG  161 (170)
Q Consensus        82 ~~iK~~~~~VS~ADiialAa~~av~~~GgP~~~v~~GR~D~~~s~~~~~lP~p~~~~~~l~~~F~~~~Gl~~~e~VaL~G  161 (170)
                      ++||+++++|||||||+||||+||+.+|||.|+|++||+|++++.++++||.|+.++++|++.|++++||+++|||||+|
T Consensus        93 ~~iK~~~~~VScADilalAardaV~~~GGP~~~v~~GRrD~~~s~~~~~lP~p~~~~~~l~~~F~~~~Gl~~~d~VaLsG  172 (261)
T 2vcn_A           93 EPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDKPEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSG  172 (261)
T ss_dssp             HHHHHTCTTSCHHHHHHHHHHHHHHHTTCCCCCCCCCCCCCSSCCCSCCSCCTTCCHHHHHHHHTTTTCCCHHHHHHHHG
T ss_pred             HHHHHHhCCCCHHHHHHHHhhhheeeccCCcccCcCCCCCCCCCCcccccCCcccCHHHHHHHHHhhCCCChHHheeecc
Confidence            99999999999999999999999999999999999999999999888999999999999999994499999999999999


Q ss_pred             cccccccCC
Q 030837          162 GHTLVSAKL  170 (170)
Q Consensus       162 aHtiG~~hc  170 (170)
                      |||||++||
T Consensus       173 aHTiG~ahc  181 (261)
T 2vcn_A          173 GHTIGAAHK  181 (261)
T ss_dssp             GGGSCEECT
T ss_pred             Ccccccccc
Confidence            999999999
>1qgj_A Peroxidase N; oxidoreductase; HET: HEM GSH; 1.90A {Arabidopsis thaliana} SCOP: a.93.1.1 Back     alignment and structure
>3hdl_A Royal PALM TREE peroxidase; glycosylated, oxidoreductase; HET: HEM MES NAG FUC MAN; 1.85A {Roystonea regia} SCOP: a.93.1.0 Back     alignment and structure
>1fhf_A SEED coat peroxidase; oxidoreductase; HET: HEM; 2.80A {Glycine max} SCOP: a.93.1.1 Back     alignment and structure
>1sch_A PNP, peanut peroxidase, major cationic isozyme; calcium binding, glycosylation, oxidoreductase; HET: NAG HEM; 2.56A {Arachis hypogaea} SCOP: a.93.1.1 Back     alignment and structure
>1gwu_A Peroxidase C1A; oxidoreductase, glycoprotein, heme, multigene family, signal,; HET: HEM; 1.31A {Armoracia rusticana} SCOP: a.93.1.1 PDB: 1w4w_A* 1w4y_A* 1gwo_A* 2atj_A* 1gwt_A* 3atj_A* 1gx2_A* 7atj_A* 1h55_A* 1h58_A* 1h5a_A* 1h5c_A* 1h5d_A* 1h5e_A* 1h5f_A* 1h57_A* 1h5h_A* 1h5i_A* 1h5j_A* 1h5k_A* ... Back     alignment and structure
>1pa2_A Peroxidase, ATP A2; oxidoreductase; HET: HEM; 1.45A {Arabidopsis thaliana} SCOP: a.93.1.1 PDB: 1qo4_A* Back     alignment and structure
>1iyn_A Chloroplastic ascorbate peroxidase; hydrogen peroxide, tobacco plant, stromal ascorbate peroxidase, oxidoreductase; HET: HEM; 1.60A {Nicotiana tabacum} SCOP: a.93.1.1 Back     alignment and structure
>1bgp_A Barley grain peroxidase; chromoprotein, oxidoreductase; HET: HEM; 1.90A {Hordeum vulgare} SCOP: a.93.1.1 Back     alignment and structure
>3e2o_A CCP, cytochrome C peroxidase; cytochrome C peroxidase (CCP), heme, hydrogen peroxide, iron, metal-binding, mitochondrion; HET: HEM; 1.06A {Saccharomyces cerevisiae} SCOP: a.93.1.1 PDB: 4a71_A* 1z53_A* 1kok_A* 1sbm_A* 1sdq_A* 1s73_A* 1zby_A* 1zbz_A* 2b0z_A* 2b10_A* 2b11_A* 2b12_A* 2cyp_A* 2ycg_A* 4a6z_A* 2v23_A* 1ebe_A* 3r98_A* 3r99_A* 1mkr_A* ... Back     alignment and structure
>3riv_A Ascorbate peroxidase; alpha helical bundle, heme peroxidase, oxidoreductase; HET: HEM; 1.76A {Leishmania major} PDB: 3riw_A* 4ged_A* Back     alignment and structure
>1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 Back     alignment and structure
>2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* Back     alignment and structure
>1u2k_A Peroxidase/catalase HPI; KATG, catalase-peroxidase, C-terminal domain, oxidoreductase; 2.00A {Escherichia coli} SCOP: a.93.1.3 PDB: 1u2l_A 1u2j_A Back     alignment and structure
>1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 Back     alignment and structure
>3fmu_A VersatIle peroxidase VPL2; class II (fungal) peroxidases, protoporphyrin IX, electron T lignin peroxidase, lignin degradation; HET: HEM; 1.04A {Pleurotus eryngii} PDB: 3fjw_A* 2boq_A* 3fm1_A* 3fm4_A* 3fm6_A* 3fkg_A* 2w23_A* 2vka_A* 4fcn_A* 4g05_A* 4fcs_A* 4fef_A* 4fdq_A* Back     alignment and structure
>3q3u_A Lignin peroxidase; oxidoreductase; HET: HEM; 1.85A {Trametes cervina} SCOP: a.93.1.0 Back     alignment and structure
>3rrw_A Thylakoid lumenal 29 kDa protein, chloroplastic; chloroplast thylakoid lumen, plant protein; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3m5q_A Manganese peroxidase 1; heme, Mn(II)-binding site, Ca(II)-binding site, glycosylation, ultrahigh resolution, calcium; HET: NAG MAN HEM; 0.93A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1mnp_A* 1yyg_A* 1yzp_A* 1yzr_A* 1yyd_A* 3m8m_A* 1mn1_A* 1mn2_A* Back     alignment and structure
>2e39_A Peroxidase; heme protein, coordination geometry of heme iron, ARP, perox oxidoreductase; HET: NAG MAN HEM; 1.30A {'arthromyces ramosus'} SCOP: a.93.1.1 PDB: 1arp_A* 1arv_A* 1arw_A* 1arx_A* 1ary_A* 1c8i_A* 1ck6_A* 1gza_A* 1gzb_A* 1hsr_A* 1aru_A* 2e3a_A* 2e3b_A* 1lyk_A* 1lyc_A* 1ly9_A* 1h3j_A* 1ly8_A* Back     alignment and structure
>3vli_A Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1.70A {Haloarcula marismortui} PDB: 3vlh_A* 3vlj_A* 3vlk_A* 3vll_A* 3uw8_A* 3vlm_A* 1itk_A* Back     alignment and structure
>1llp_A LIP4.15, lignin peroxidase; heme protein, glyco protein,, oxidoreductase; HET: NAG MAN A2G HEM; 1.70A {Phanerochaete chrysosporium} SCOP: a.93.1.1 PDB: 1lga_A* 1b80_A* 1b82_A* 1b85_A* 1qpa_A* Back     alignment and structure
>3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} Back     alignment and structure
>3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* Back     alignment and structure
>1itk_A Catalase-peroxidase; heme protein, oxidoreductase; HET: HEM; 2.00A {Haloarcula marismortui} SCOP: a.93.1.3 a.93.1.3 Back     alignment and structure
>2cca_A Peroxidase/catalase T; oxidoreductase, catalase-peroxidase, KATG, heme, hydrogen peroxide, iron, metal-binding, organic radical; HET: HEM; 2.0A {Mycobacterium tuberculosis} SCOP: a.93.1.3 a.93.1.3 PDB: 1sj2_A* 2ccd_A* Back     alignment and structure
>1ub2_A Catalase-peroxidase; KATG, cyanobacteria, oxidoreductase; HET: HEM; 2.40A {Synechococcus elongatus} SCOP: a.93.1.3 a.93.1.3 Back     alignment and structure
>3vli_A Catalase-peroxidase 2; oxidoreductase; HET: HEM; 1.70A {Haloarcula marismortui} PDB: 3vlh_A* 3vlj_A* 3vlk_A* 3vll_A* 3uw8_A* 3vlm_A* 1itk_A* Back     alignment and structure
>3n3r_A Catalase-peroxidase; E198A variant, tuberclosis, isonicotini hydrazide binding, oxidoreductase; HET: TOX HEM; 1.60A {Burkholderia pseudomallei} PDB: 3n3s_A* 3n3o_A* 2fxj_A* 3n3p_A* 2fxg_A* 3n3n_A* 2fxh_A* 2dv2_A* 3n3q_A* 2dv1_A* 1x7u_A* 1mwv_A* 2b2o_A* 2b2q_A* 2b2r_A* 2b2s_A* Back     alignment and structure
>3ut2_A Catalase-peroxidase 2; KATG, fungal, heme enzyme, oxidoreducta; HET: TOX HEM; 1.55A {Magnaporthe oryzae 70-15} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 170
d1oafa_250 a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glyci 6e-62
d2euta1 291 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {B 1e-46
d1iyna_ 275 a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco 3e-43
d1yyda1 357 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) { 2e-38
d1ub2a1 406 a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Syne 5e-34
d1llpa_ 343 a.93.1.1 (A:) Fungal peroxidase (ligninase) {White 3e-33
d2e39a1 336 a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) { 5e-33
d1mwva1 406 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burk 1e-30
d2ccaa1 410 a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Myco 1e-30
d1itka1 406 a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Arch 3e-30
d1itka2 308 a.93.1.3 (A:424-731) Catalase-peroxidase KatG {Arc 2e-28
d1qgja_ 300 a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (A 9e-27
d1gwua_ 307 a.93.1.1 (A:) Plant peroxidase {Horseradish (Armor 3e-26
d2ccaa2285 a.93.1.3 (A:436-720) Catalase-peroxidase KatG {Myc 5e-26
d1scha_ 294 a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hy 2e-25
d1ub2a2 294 a.93.1.3 (A:427-720) Catalase-peroxidase KatG {Syn 2e-25
d1pa2a_ 306 a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (A 3e-25
d1mwva2 308 a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Bur 3e-24
d1fhfa_ 304 a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine m 4e-24
d1u2ka_ 292 a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholder 5e-24
d1bgpa_ 309 a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vu 1e-20
>d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} Length = 250 Back     information, alignment and structure

class: All alpha proteins
fold: Heme-dependent peroxidases
superfamily: Heme-dependent peroxidases
family: CCP-like
domain: Ascorbate peroxidase
species: Soybean (Glycine max) [TaxId: 3847]

 Score =  189 bits (481), Expect = 6e-62
 Identities = 127/163 (77%), Positives = 144/163 (88%)

Query: 3   KNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRL 62
           K+YPTVS DY+KAVEK K+KLRGFIAEK CAPLMLR+AWHSAGT+D  TKTGGPFGT++ 
Sbjct: 3   KSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTIKH 62

Query: 63  AAEQAHSANNGLDIAVRLLEPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDK 122
            AE AHSANNGLDIAVRLLEP K +FP +SYAD YQLAGVV VEVTGGP++PFHPGR+DK
Sbjct: 63  PAELAHSANNGLDIAVRLLEPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDK 122

Query: 123 AEPPQEGRLPDAKQGNDHLRQVFGAQMGLSDKDIVALSGGHTL 165
            EPP EGRLPDA +G+DHLR VFG  MGL+D+DIVALSGGHT+
Sbjct: 123 PEPPPEGRLPDATKGSDHLRDVFGKAMGLTDQDIVALSGGHTI 165
>d2euta1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 291 Back     information, alignment and structure
>d1iyna_ a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 275 Back     information, alignment and structure
>d1yyda1 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) {Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 357 Back     information, alignment and structure
>d1ub2a1 a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} Length = 406 Back     information, alignment and structure
>d1llpa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {White rot basidiomycete (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 343 Back     information, alignment and structure
>d2e39a1 a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]} Length = 336 Back     information, alignment and structure
>d1mwva1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Length = 406 Back     information, alignment and structure
>d2ccaa1 a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} Length = 410 Back     information, alignment and structure
>d1itka1 a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 406 Back     information, alignment and structure
>d1itka2 a.93.1.3 (A:424-731) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 308 Back     information, alignment and structure
>d1qgja_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase N [TaxId: 3702]} Length = 300 Back     information, alignment and structure
>d1gwua_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]} Length = 307 Back     information, alignment and structure
>d2ccaa2 a.93.1.3 (A:436-720) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} Length = 285 Back     information, alignment and structure
>d1scha_ a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 294 Back     information, alignment and structure
>d1ub2a2 a.93.1.3 (A:427-720) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} Length = 294 Back     information, alignment and structure
>d1pa2a_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase A2 [TaxId: 3702]} Length = 306 Back     information, alignment and structure
>d1mwva2 a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Length = 308 Back     information, alignment and structure
>d1fhfa_ a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]} Length = 304 Back     information, alignment and structure
>d1u2ka_ a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Length = 292 Back     information, alignment and structure
>d1bgpa_ a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vulgare), peroxidase 1 [TaxId: 4513]} Length = 309 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query170
d1oafa_250 Ascorbate peroxidase {Soybean (Glycine max) [TaxId 100.0
d1fhfa_ 304 Plant peroxidase {Soybean (Glycine max) [TaxId: 38 100.0
d1pa2a_ 306 Plant peroxidase {Mouse-ear cress (Arabidopsis tha 100.0
d1qgja_ 300 Plant peroxidase {Mouse-ear cress (Arabidopsis tha 100.0
d1iyna_ 275 Ascorbate peroxidase {Common tobacco (Nicotiana ta 100.0
d1gwua_ 307 Plant peroxidase {Horseradish (Armoracia rusticana 100.0
d1scha_ 294 Plant peroxidase {Peanut (Arachis hypogaea) [TaxId 100.0
d1bgpa_ 309 Plant peroxidase {Barley (Hordeum vulgare), peroxi 100.0
d2euta1 291 Cytochrome c peroxidase, CCP {Baker's yeast (Sacch 100.0
d1yyda1 357 Fungal peroxidase (ligninase) {Basidomycetos fungu 100.0
d2e39a1 336 Fungal peroxidase (ligninase) {Arthromyces ramosus 100.0
d1llpa_ 343 Fungal peroxidase (ligninase) {White rot basidiomy 100.0
d1itka1 406 Catalase-peroxidase KatG {Archaeon Haloarcula mari 100.0
d1mwva1 406 Catalase-peroxidase KatG {Burkholderia pseudomalle 100.0
d1mwva2 308 Catalase-peroxidase KatG {Burkholderia pseudomalle 100.0
d2ccaa2285 Catalase-peroxidase KatG {Mycobacterium tuberculos 100.0
d1u2ka_ 292 Catalase-peroxidase KatG {Burkholderia pseudomalle 100.0
d1ub2a1 406 Catalase-peroxidase KatG {Synechococcus sp. pcc 79 100.0
d2ccaa1 410 Catalase-peroxidase KatG {Mycobacterium tuberculos 100.0
d1ub2a2 294 Catalase-peroxidase KatG {Synechococcus sp. pcc 79 100.0
d1itka2 308 Catalase-peroxidase KatG {Archaeon Haloarcula mari 100.0
>d1oafa_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
class: All alpha proteins
fold: Heme-dependent peroxidases
superfamily: Heme-dependent peroxidases
family: CCP-like
domain: Ascorbate peroxidase
species: Soybean (Glycine max) [TaxId: 3847]

Probab=100.00  E-value=1.9e-54  Score=353.95  Aligned_cols=168  Identities=76%  Similarity=1.251  Sum_probs=163.2

Q ss_pred             CCCCCChhHHHHHHHHHHHHHhhhhhhcCCchHHHHHHHhhhccccCCCCCCCCCCCccccHHHhhccCcCchHHHHHHH
Q 030837            2 TKNYPTVSEDYKKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTYDVKTKTGGPFGTMRLAAEQAHSANNGLDIAVRLL   81 (170)
Q Consensus         2 ~~~cp~~~~~v~~~v~~~~~~l~~~~~~~~~a~~~lRL~fHDc~~~d~s~~~gG~dgsi~~~~E~~~~~N~gl~~~~~~i   81 (170)
                      .|+||.++.+|+++|++++++|++++.|++++|++|||+||||++|+.+...||+||++++.+|+++++|.||+...+++
T Consensus         2 ~ks~p~~~~~~~~~~~~~~~~~~~~~~~~~~ap~llRl~FHDc~tf~~~~~~gg~~gs~~~~~E~~~~~N~Gl~~i~~~~   81 (250)
T d1oafa_           2 GKSYPTVSADYQKAVEKAKKKLRGFIAEKRCAPLMLRLAWHSAGTFDKGTKTGGPFGTIKHPAELAHSANNGLDIAVRLL   81 (250)
T ss_dssp             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHTTCBTTTTBCSSSSGGGSHHHHTSGGGTTHHHHHHHH
T ss_pred             CCCCCCchHHHHHHHHHHHHHHHHHHhccCcHHHHHHHHHcccccccCCCCCCCCCcccccccccccccccCHHHHHHHH
Confidence            48999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhHHhhCCCCcHHHHHHHHhhhHhhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHH-hcCCChhhHHHhh
Q 030837           82 EPFKEQFPTISYADLYQLAGVVGVEVTGGPDIPFHPGRDDKAEPPQEGRLPDAKQGNDHLRQVFGA-QMGLSDKDIVALS  160 (170)
Q Consensus        82 ~~iK~~~~~VS~ADiialAa~~av~~~GgP~~~v~~GR~D~~~s~~~~~lP~p~~~~~~l~~~F~~-~~Gl~~~e~VaL~  160 (170)
                      +++|+++|.|||||||+||+++||+++|||.|+|++||+|+..+.+++.+|.|..+++++++.| . .+||+++|||||+
T Consensus        82 ~~~~~~~p~VS~ADiialAa~~Av~~~GGp~~~~~~GR~D~~~~~~~g~~P~p~~~~~~l~~~F-~~~~Gl~~~e~VaL~  160 (250)
T d1oafa_          82 EPLKAEFPILSYADFYQLAGVVAVEVTGGPEVPFHPGREDKPEPPPEGRLPDATKGSDHLRDVF-GKAMGLTDQDIVALS  160 (250)
T ss_dssp             HHHHHTCTTSCHHHHHHHHHHHHHHHTTCCCCCCCCCCCCCSSCCCSCCSCCTTCCHHHHHHHH-TTTTCCCHHHHHHHH
T ss_pred             HHHHhccCcccHHHHHHHHHHHHHHhcCCceeccCCCCccccCCCCcccCCChHHHHHHHHHHH-HHhcCCCHHHHHHHh
Confidence            9999999999999999999999999999999999999999999999999999999999999999 6 5799999999999


Q ss_pred             ccccccccCC
Q 030837          161 GGHTLVSAKL  170 (170)
Q Consensus       161 GaHtiG~~hc  170 (170)
                      ||||||++||
T Consensus       161 GaHTiG~~h~  170 (250)
T d1oafa_         161 GGHTIGAAHK  170 (250)
T ss_dssp             GGGGSCEECT
T ss_pred             hhhhhhhhcc
Confidence            9999999998
>d1fhfa_ a.93.1.1 (A:) Plant peroxidase {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1pa2a_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase A2 [TaxId: 3702]} Back     information, alignment and structure
>d1qgja_ a.93.1.1 (A:) Plant peroxidase {Mouse-ear cress (Arabidopsis thaliana), peroxidase N [TaxId: 3702]} Back     information, alignment and structure
>d1iyna_ a.93.1.1 (A:) Ascorbate peroxidase {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1gwua_ a.93.1.1 (A:) Plant peroxidase {Horseradish (Armoracia rusticana) [TaxId: 3704]} Back     information, alignment and structure
>d1scha_ a.93.1.1 (A:) Plant peroxidase {Peanut (Arachis hypogaea) [TaxId: 3818]} Back     information, alignment and structure
>d1bgpa_ a.93.1.1 (A:) Plant peroxidase {Barley (Hordeum vulgare), peroxidase 1 [TaxId: 4513]} Back     information, alignment and structure
>d2euta1 a.93.1.1 (A:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yyda1 a.93.1.1 (A:1-357) Fungal peroxidase (ligninase) {Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d2e39a1 a.93.1.1 (A:9-344) Fungal peroxidase (ligninase) {Arthromyces ramosus [TaxId: 5451]} Back     information, alignment and structure
>d1llpa_ a.93.1.1 (A:) Fungal peroxidase (ligninase) {White rot basidiomycete (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1itka1 a.93.1.3 (A:18-423) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1mwva1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1mwva2 a.93.1.3 (A:441-748) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d2ccaa2 a.93.1.3 (A:436-720) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u2ka_ a.93.1.3 (A:) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1ub2a1 a.93.1.3 (A:21-426) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} Back     information, alignment and structure
>d2ccaa1 a.93.1.3 (A:26-435) Catalase-peroxidase KatG {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ub2a2 a.93.1.3 (A:427-720) Catalase-peroxidase KatG {Synechococcus sp. pcc 7942 [TaxId: 1140]} Back     information, alignment and structure
>d1itka2 a.93.1.3 (A:424-731) Catalase-peroxidase KatG {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure