Citrus Sinensis ID: 030842

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
MALSLSLHLPVTPVLPKAYVQSKPPPVSHYISLRRLRLTSATALGKNRSVLVKAVERSQESAEKSETVNEPESEPANPATESSAELSELGSEIKKVLKEKKEEKAGDLLSGVGEEIREIEWPAFGKVLGTTGVVLGVIAGSSVVLLTVNFVLAELSDRAFAGRGVQDFFR
ccccEEEccccccccccccccccccccccccccHHHHHHHccccccccHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHccccccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHcccccccccc
********LPVTPVLPKAYV******VSHYISLRRLRLTSATALG***************************************************************LSGVGEEIREIEWPAFGKVLGTTGVVLGVIAGSSVVLLTVNFVLAELSDRAFAGRGVQDFFR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALSLSLHLPVTPVLPKAYVQSKPPPVSHYISLRRLRLTSATALGKNRSVLVKAVERSQESAEKSETVNEPESEPANPATESSAELSELGSEIKKVLKEKKEEKAGDLLSGVGEEIREIEWPAFGKVLGTTGVVLGVIAGSSVVLLTVNFVLAELSDRAFAGRGVQDFFR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Preprotein translocase subunit SECE1 Involved in the import/insertion pathway in the thylakoids. The signal recognition particle is not involved in the insertion of SECE1 in the thylakoid membrane.probableO23342

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DL8, chain C
Confidence level:confident
Coverage over the Query: 129-162
View the alignment between query and template
View the model in PyMOL