Citrus Sinensis ID: 030848

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170

MFSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDG

cHHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHccccccccccccccccccccEEEEEEccEEEEEEEcccccccccHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHcccccccccEEEEEccccccccccHHHHHHHccccccccccEEEEEEEEccc

MFSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYD*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MFSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ADP-ribosylation factor 6	GTP-binding protein that functions as a molecular switch for the activation of 'new end take off' (NETO), a process in which the directions of cell growth change from a monopolar manner to a bipolar manner in fission yeast. Involved in supplying membrane to the growing new end.	probable	Q9Y7Z2
ADP-ribosylation factor-related protein 1	Possibly involved in plasma membrane-related signaling events.	probable	Q5R579
ADP-ribosylation factor-related protein 1	Possibly involved in plasma membrane-related signaling events.	probable	Q8BXL7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X77, chain A
Confidence level:very confident
Coverage over the Query: 4-170
View the alignment between query and template
View the model in PyMOL