Citrus Sinensis ID: 030848


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
MFSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDG
cHHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHccccccccccccccccccccEEEEEEccEEEEEEEcccccccccHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHcccccccccEEEEEccccccccccHHHHHHHccccccccccEEEEEEEEccc
MFSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ADP-ribosylation factor 6 GTP-binding protein that functions as a molecular switch for the activation of 'new end take off' (NETO), a process in which the directions of cell growth change from a monopolar manner to a bipolar manner in fission yeast. Involved in supplying membrane to the growing new end.probableQ9Y7Z2
ADP-ribosylation factor-related protein 1 Possibly involved in plasma membrane-related signaling events.probableQ5R579
ADP-ribosylation factor-related protein 1 Possibly involved in plasma membrane-related signaling events.probableQ8BXL7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X77, chain A
Confidence level:very confident
Coverage over the Query: 4-170
View the alignment between query and template
View the model in PyMOL