Citrus Sinensis ID: 030851

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQERLVKGAGFVHENFGIYRTLEELWDGEI
cHHHHHccccEEEEEccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHcccEEEEEcccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHcccEEEEccccHHHHHHHHccccccccHHHHHHcccccccccccccccccccccccccccccccccc
HHHHHHcccEccEEEEcccHHHHHHHHccccccccEEEEEcEccEccHHHHHHHHHHccEEEEEccccccccccccccccccHHHHHcccccHHHHHHHHHHHcccEEccccccHHHHHHHHccccccccHHHHHHHccccHcccccccccccccccccccHHHHHcccc
mealydsgkaraigvsNFSLKKLgdlleiarippavnqvechpawqQTKLQAFCKskgvhlsgysplgsaknthrvlqnpIVNTVAEKLGKSPAQVALRWGLqmghsvlpksanearlkenfdifdwyipedllakfpeIEQERLVkgagfvhenfgiYRTLEELWDGEI
mealydsgkaraigvsnFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQERLVKgagfvhenfgiyrtleelwdgei
MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQERLVKGAGFVHENFGIYRTLEELWDGEI
**********RAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQERLVKGAGFVHENFGIYRTLEELW****
MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQERLVKGAGFVHENFGIYRTLEELWDGEI
********KARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQERLVKGAGFVHENFGIYRTLEELWDGEI
MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQERLVKGAGFVHENFGIYRTLEELWDGEI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQERLVKGAGFVHENFGIYRTLEELWDGEI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query170 2.2.26 [Sep-21-2011]
Q0PGJ6315 Aldo-keto reductase famil yes no 1.0 0.539 0.757 2e-73
Q84TF0314 Aldo-keto reductase famil no no 0.994 0.538 0.722 3e-68
O80944311 Aldo-keto reductase famil no no 1.0 0.546 0.710 6e-68
Q9M338315 Aldo-keto reductase famil no no 1.0 0.539 0.682 8e-68
Q7G765322 Probable NAD(P)H-dependen no no 0.976 0.515 0.470 3e-36
Q9SQ64321 Non-functional NADPH-depe N/A no 0.988 0.523 0.465 4e-36
P23901320 Aldose reductase OS=Horde N/A no 0.982 0.521 0.432 1e-35
Q7G764321 Probable NAD(P)H-dependen no no 0.994 0.526 0.427 1e-34
P26690315 NAD(P)H-dependent 6'-deox no no 0.952 0.514 0.418 6e-32
Q9SQ70321 NADPH-dependent codeinone N/A no 0.976 0.517 0.423 1e-31
>sp|Q0PGJ6|AKRC9_ARATH Aldo-keto reductase family 4 member C9 OS=Arabidopsis thaliana GN=AKR4C9 PE=1 SV=1 Back     alignment and function desciption
 Score =  274 bits (701), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 131/173 (75%), Positives = 146/173 (84%), Gaps = 3/173 (1%)

Query: 1   MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVH 60
           MEALYDSGKARAIGVSNFS KKL DLLE+AR+PPAVNQVECHP+W+QTKLQ FCKSKGVH
Sbjct: 143 MEALYDSGKARAIGVSNFSTKKLADLLELARVPPAVNQVECHPSWRQTKLQEFCKSKGVH 202

Query: 61  LSGYSPLGSAKNT---HRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEAR 117
           LS YSPLGS   T     VL+NPI+N VAEKLGKSPAQVALRWGLQMGHSVLPKS NE R
Sbjct: 203 LSAYSPLGSPGTTWLKSDVLKNPILNMVAEKLGKSPAQVALRWGLQMGHSVLPKSTNEGR 262

Query: 118 LKENFDIFDWYIPEDLLAKFPEIEQERLVKGAGFVHENFGIYRTLEELWDGEI 170
           +KENF++FDW IP+ + AKF EIEQ RLV G+  VHE    Y+++EELWDGEI
Sbjct: 263 IKENFNVFDWSIPDYMFAKFAEIEQARLVTGSFLVHETLSPYKSIEELWDGEI 315
Oxidoreductase acting on a broad range of substrates: reduces ketosteroids, aromatic aldehydes, ketones, sugars and other aliphatic aldehydes, and oxidizes hydroxysteroids. May function as detoxifiying enzyme by reducing a range of toxic aldehydes and ketones produced during stress.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q84TF0|AKRCA_ARATH Aldo-keto reductase family 4 member C10 OS=Arabidopsis thaliana GN=AKR4C10 PE=1 SV=1 Back     alignment and function description
>sp|O80944|AKRC8_ARATH Aldo-keto reductase family 4 member C8 OS=Arabidopsis thaliana GN=AKR4C8 PE=1 SV=2 Back     alignment and function description
>sp|Q9M338|AKRCB_ARATH Aldo-keto reductase family 4 member C11 OS=Arabidopsis thaliana GN=AKR4C11 PE=2 SV=1 Back     alignment and function description
>sp|Q7G765|NADO2_ORYSJ Probable NAD(P)H-dependent oxidoreductase 2 OS=Oryza sativa subsp. japonica GN=Os10g0113100 PE=2 SV=1 Back     alignment and function description
>sp|Q9SQ64|COR2_PAPSO Non-functional NADPH-dependent codeinone reductase 2 OS=Papaver somniferum GN=COR2 PE=1 SV=1 Back     alignment and function description
>sp|P23901|ALDR_HORVU Aldose reductase OS=Hordeum vulgare PE=1 SV=1 Back     alignment and function description
>sp|Q7G764|NADO1_ORYSJ Probable NAD(P)H-dependent oxidoreductase 1 OS=Oryza sativa subsp. japonica GN=Os10g0113000 PE=1 SV=1 Back     alignment and function description
>sp|P26690|6DCS_SOYBN NAD(P)H-dependent 6'-deoxychalcone synthase OS=Glycine max PE=1 SV=1 Back     alignment and function description
>sp|Q9SQ70|COR11_PAPSO NADPH-dependent codeinone reductase 1-1 OS=Papaver somniferum GN=COR1.1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query170
225440476 313 PREDICTED: aldo-keto reductase family 4 1.0 0.543 0.752 3e-74
388520373 315 unknown [Lotus japonicus] 1.0 0.539 0.774 3e-74
255577997 315 aldo-keto reductase, putative [Ricinus c 1.0 0.539 0.763 8e-74
356496078 315 PREDICTED: aldo-keto reductase family 4 1.0 0.539 0.757 3e-73
388513445 315 unknown [Medicago truncatula] 1.0 0.539 0.745 9e-73
224140305 318 predicted protein [Populus trichocarpa] 0.994 0.531 0.779 1e-72
358248130 315 uncharacterized protein LOC100781137 [Gl 1.0 0.539 0.757 1e-72
297823651 315 oxidoreductase [Arabidopsis lyrata subsp 1.0 0.539 0.757 2e-72
297740315 368 unnamed protein product [Vitis vinifera] 0.994 0.459 0.735 6e-72
79324628 315 NAD(P)-linked oxidoreductase-like protei 1.0 0.539 0.757 7e-72
>gi|225440476|ref|XP_002272736.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  282 bits (722), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 150/174 (86%), Gaps = 4/174 (2%)

Query: 1   MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVH 60
           ME LYDSGKARAIGVSNFS KKLGDLL++AR+PPAVNQVECHP+WQQ +L +FCKS GVH
Sbjct: 140 METLYDSGKARAIGVSNFSTKKLGDLLKVARVPPAVNQVECHPSWQQPQLHSFCKSNGVH 199

Query: 61  LSGYSPLGSAKNT----HRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEA 116
           LS Y+P+GS   T     ++L++P++N +AEKLGKSPAQVALRWGLQMGHSVLPKS NE 
Sbjct: 200 LSAYAPMGSPGGTSGKSRQLLKDPVLNMIAEKLGKSPAQVALRWGLQMGHSVLPKSTNEG 259

Query: 117 RLKENFDIFDWYIPEDLLAKFPEIEQERLVKGAGFVHENFGIYRTLEELWDGEI 170
           RLKENFD+FDW IPEDL AKF EIEQ RLV G+ FVHE FG+YR+LEELWDGEI
Sbjct: 260 RLKENFDVFDWSIPEDLFAKFSEIEQVRLVTGSNFVHETFGVYRSLEELWDGEI 313

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|388520373|gb|AFK48248.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255577997|ref|XP_002529870.1| aldo-keto reductase, putative [Ricinus communis] gi|223530646|gb|EEF32520.1| aldo-keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356496078|ref|XP_003516897.1| PREDICTED: aldo-keto reductase family 4 member C9-like [Glycine max] Back     alignment and taxonomy information
>gi|388513445|gb|AFK44784.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|224140305|ref|XP_002323523.1| predicted protein [Populus trichocarpa] gi|222868153|gb|EEF05284.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|358248130|ref|NP_001240076.1| uncharacterized protein LOC100781137 [Glycine max] gi|255635916|gb|ACU18305.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297823651|ref|XP_002879708.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi|297325547|gb|EFH55967.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297740315|emb|CBI30497.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|79324628|ref|NP_001031505.1| NAD(P)-linked oxidoreductase-like protein [Arabidopsis thaliana] gi|122241485|sp|Q0PGJ6.1|AKRC9_ARATH RecName: Full=Aldo-keto reductase family 4 member C9 gi|111182165|gb|ABH07515.1| aldo-keto reductase [Arabidopsis thaliana] gi|330254355|gb|AEC09449.1| NAD(P)-linked oxidoreductase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query170
TAIR|locus:2040646315 ChlAKR "Chloroplastic aldo-ket 1.0 0.539 0.757 1.5e-67
TAIR|locus:2065639314 AKR4C10 "Aldo-keto reductase f 0.994 0.538 0.722 3.3e-63
TAIR|locus:2084505315 AKR4C11 "Aldo-keto reductase f 1.0 0.539 0.682 8.8e-63
TAIR|locus:2040751311 AKR4C8 "Aldo-keto reductase fa 1.0 0.546 0.722 1.4e-62
TAIR|locus:2025926320 AT1G59950 [Arabidopsis thalian 0.994 0.528 0.454 9.2e-36
UNIPROTKB|Q9SQ64321 COR2 "Non-functional NADPH-dep 0.982 0.520 0.48 1.9e-35
TAIR|locus:2149715349 AT5G01670 [Arabidopsis thalian 0.994 0.484 0.426 1.3e-34
TAIR|locus:2154164316 AT5G62420 [Arabidopsis thalian 1.0 0.537 0.421 1.7e-34
UNIPROTKB|E7C196327 E7C196 "2-carbomethoxy-3-tropi 0.994 0.516 0.427 6e-32
TAIR|locus:2025936326 AT1G59960 [Arabidopsis thalian 0.994 0.518 0.425 5.4e-31
TAIR|locus:2040646 ChlAKR "Chloroplastic aldo-keto reductase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 686 (246.5 bits), Expect = 1.5e-67, P = 1.5e-67
 Identities = 131/173 (75%), Positives = 146/173 (84%)

Query:     1 MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVH 60
             MEALYDSGKARAIGVSNFS KKL DLLE+AR+PPAVNQVECHP+W+QTKLQ FCKSKGVH
Sbjct:   143 MEALYDSGKARAIGVSNFSTKKLADLLELARVPPAVNQVECHPSWRQTKLQEFCKSKGVH 202

Query:    61 LSGYSPLGSAKNT---HRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEAR 117
             LS YSPLGS   T     VL+NPI+N VAEKLGKSPAQVALRWGLQMGHSVLPKS NE R
Sbjct:   203 LSAYSPLGSPGTTWLKSDVLKNPILNMVAEKLGKSPAQVALRWGLQMGHSVLPKSTNEGR 262

Query:   118 LKENFDIFDWYIPEDLLAKFPEIEQERLVKGAGFVHENFGIYRTLEELWDGEI 170
             +KENF++FDW IP+ + AKF EIEQ RLV G+  VHE    Y+++EELWDGEI
Sbjct:   263 IKENFNVFDWSIPDYMFAKFAEIEQARLVTGSFLVHETLSPYKSIEELWDGEI 315
GO:0005737 "cytoplasm" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA;IDA
GO:0004033 "aldo-keto reductase (NADP) activity" evidence=IDA
GO:0009409 "response to cold" evidence=IEP
GO:0009414 "response to water deprivation" evidence=IEP
GO:0009651 "response to salt stress" evidence=IEP
GO:0016229 "steroid dehydrogenase activity" evidence=IDA
GO:0070401 "NADP+ binding" evidence=IDA
GO:0008106 "alcohol dehydrogenase (NADP+) activity" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2065639 AKR4C10 "Aldo-keto reductase family 4 member C10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084505 AKR4C11 "Aldo-keto reductase family 4 member C11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040751 AKR4C8 "Aldo-keto reductase family 4 member C8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025926 AT1G59950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SQ64 COR2 "Non-functional NADPH-dependent codeinone reductase 2" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
TAIR|locus:2149715 AT5G01670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154164 AT5G62420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E7C196 E7C196 "2-carbomethoxy-3-tropinone reductase" [Erythroxylum coca (taxid:289672)] Back     alignment and assigned GO terms
TAIR|locus:2025936 AT1G59960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0PGJ6AKRC9_ARATH1, ., 1, ., 1, ., -0.75721.00.5396yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query170
COG0656280 COG0656, ARA1, Aldo/keto reductases, related to di 8e-56
cd06660285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 1e-45
PRK11565275 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A 2e-30
pfam00248277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 2e-30
PRK11172267 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B 3e-27
COG0667316 COG0667, Tas, Predicted oxidoreductases (related t 6e-15
COG4989298 COG4989, COG4989, Predicted oxidoreductase [Genera 6e-07
PRK10376290 PRK10376, PRK10376, putative oxidoreductase; Provi 1e-05
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information 
 Score =  176 bits (449), Expect = 8e-56
 Identities = 61/136 (44%), Positives = 89/136 (65%), Gaps = 3/136 (2%)

Query: 1   MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVH 60
           +E L D G  RAIGVSNF ++ L +LL +A++ PAVNQ+E HP  +Q +L  FC+  G+ 
Sbjct: 126 LEELVDEGLIRAIGVSNFGVEHLEELLSLAKVKPAVNQIEYHPYLRQPELLPFCQRHGIA 185

Query: 61  LSGYSPLGSAKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKE 120
           +  YSPL       ++L NP++  +A+K GK+PAQVALRW +Q G  V+PKS    R++E
Sbjct: 186 VEAYSPLAKGG---KLLDNPVLAEIAKKYGKTPAQVALRWHIQRGVIVIPKSTTPERIRE 242

Query: 121 NFDIFDWYIPEDLLAK 136
           N   FD+ + E+ +A 
Sbjct: 243 NLAAFDFELSEEDMAA 258

Length = 280
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information
>gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 170
COG0656280 ARA1 Aldo/keto reductases, related to diketogulona 100.0
KOG1577300 consensus Aldo/keto reductase family proteins [Gen 99.97
PRK11172267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 99.97
KOG1575336 consensus Voltage-gated shaker-like K+ channel, su 99.97
PRK11565275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 99.97
PRK10376290 putative oxidoreductase; Provisional 99.95
PRK09912346 L-glyceraldehyde 3-phosphate reductase; Provisiona 99.95
PF00248283 Aldo_ket_red: Aldo/keto reductase family; InterPro 99.95
TIGR01293317 Kv_beta voltage-dependent potassium channel beta s 99.95
COG0667316 Tas Predicted oxidoreductases (related to aryl-alc 99.95
PRK10625346 tas putative aldo-keto reductase; Provisional 99.95
cd06660285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 99.95
PLN02587314 L-galactose dehydrogenase 99.93
PRK14863292 bifunctional regulator KidO; Provisional 99.93
COG4989298 Predicted oxidoreductase [General function predict 99.92
COG1453391 Predicted oxidoreductases of the aldo/keto reducta 99.88
KOG1576342 consensus Predicted oxidoreductase [Energy product 99.71
KOG3023285 consensus Glutamate-cysteine ligase regulatory sub 98.34
PRK10558256 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro 93.95
PRK10128 267 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional 93.12
TIGR03239249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co 92.84
COG1140513 NarY Nitrate reductase beta subunit [Energy produc 90.66
TIGR02311249 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 90.28
COG1149284 MinD superfamily P-loop ATPase containing an inser 80.5
>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=2.8e-34  Score=226.51  Aligned_cols=140  Identities=44%  Similarity=0.809  Sum_probs=134.9

Q ss_pred             ChhHhhcCCccEEEecCCcHHHHHHHHHhcCCCceEeccccCccCCcHHHHHHHHHcCcceEEecCCCCCCCCCCCCCcH
Q 030851            1 MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTHRVLQNP   80 (170)
Q Consensus         1 L~~l~~~G~Ir~iGvS~~~~~~i~~~~~~~~~~~~~~q~~~n~~~~~~~~~~~~~~~gi~via~~~l~~gg~~~~~~~~~   80 (170)
                      |++++++||||+||||||+++.++++++..++.|+++|++||+..++.+++++|+++||.++||+||+.|+   .+++++
T Consensus       126 lE~l~~~G~ir~IGVSNF~~~~L~~l~~~~~~~p~~NQIe~hp~~~q~el~~~~~~~gI~v~AysPL~~g~---~l~~~~  202 (280)
T COG0656         126 LEELVDEGLIRAIGVSNFGVEHLEELLSLAKVKPAVNQIEYHPYLRQPELLPFCQRHGIAVEAYSPLAKGG---KLLDNP  202 (280)
T ss_pred             HHHHHhcCCccEEEeeCCCHHHHHHHHHhcCCCCceEEEEeccCCCcHHHHHHHHHcCCEEEEECCccccc---ccccCh
Confidence            68999999999999999999999999999999999999999999999999999999999999999999763   388999


Q ss_pred             HHHHHHHHhCCCHHHHHHHhhhcCCCEEeecCCCHHHHHHhhcccCCCCCHHHHHhchhhhcc
Q 030851           81 IVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQE  143 (170)
Q Consensus        81 ~l~~~a~~~~~s~~qlal~~~l~~~~~~i~g~~~~~~l~enl~a~~~~L~~~~~~~l~~~~~~  143 (170)
                      .+.++|++||.|++|++|+|.+++++++||.+++++|+++|+++.++.||++||+.|+++...
T Consensus       203 ~l~~Ia~k~g~t~AQv~L~W~i~~gv~~Ipks~~~~ri~eN~~~~~f~Ls~ed~~~i~~l~~~  265 (280)
T COG0656         203 VLAEIAKKYGKTPAQVALRWHIQRGVIVIPKSTTPERIRENLAAFDFELSEEDMAAIDALDRG  265 (280)
T ss_pred             HHHHHHHHhCCCHHHHHHHHHHhCCcEEecCCCCHHHHHHHHhhhcCCCCHHHHHHHHhhccc
Confidence            999999999999999999999999999999999999999999999999999999999999983

>KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] Back     alignment and domain information
>KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion] Back     alignment and domain information
>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query170
3h7u_A335 Crystal Structure Of The Plant Stress-Response Enzy 2e-74
3h7r_A331 Crystal Structure Of The Plant Stress-Response Enzy 7e-69
2bgq_A344 Apo Aldose Reductase From Barley Length = 344 6e-37
1zgd_A312 Chalcone Reductase Complexed With Nadp+ At 1.7 Angs 1e-31
4fzi_A290 Crystal Structure Of Prostaglandin F Synthase From 2e-30
3f7j_A276 B.Subtilis Yvgn Length = 276 9e-29
3d3f_A275 Crystal Structure Of Yvgn And Cofactor Nadph From B 9e-29
1cwn_A324 Crystal Structure Of Porcine Aldehyde Reductase Hol 4e-28
1ae4_A325 Aldehyde Reductase Complexed With Cofactor And Inhi 4e-28
1hqt_A326 The Crystal Structure Of An Aldehyde Reductase Y50f 4e-28
3cv7_A325 Crystal Structure Of Porcine Aldehyde Reductase Ter 6e-28
2alr_A324 Aldehyde Reductase Length = 324 5e-27
4gac_A324 High Resolution Structure Of Mouse Aldehyde Reducta 7e-27
4f40_A288 X-Ray Crystal Structure Of Apo Prostaglandin F Synt 1e-26
3b3d_A314 B.Subtilis Ytbe Length = 314 1e-26
1q5m_A322 Binary Complex Of Rabbit 20alpha-Hydroxysteroid Deh 7e-25
1vbj_A281 The Crystal Structure Of Prostaglandin F Synthase F 7e-25
1q13_A323 Crystal Structure Of Rabbit 20alpha Hyroxysteroid D 7e-25
3o0k_A283 Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL 2e-24
3bur_A326 Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta- 2e-24
3cmf_A346 Crystal Structure Of Human Liver 5beta-Reductase (A 2e-24
3uzw_A346 Crystal Structure Of 5beta-Reductase (Akr1d1) E120h 3e-24
3uwe_A331 Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length 3e-24
1ry0_A323 Structure Of Prostaglandin F Synthase With Prostagl 3e-24
1s1p_A331 Crystal Structures Of Prostaglandin D2 11-Ketoreduc 4e-24
3r43_A331 Akr1c3 Complexed With Mefenamic Acid Length = 331 4e-24
2fvl_A324 Crystal Structure Of Human 3-alpha Hydroxysteroid/d 6e-24
1vp5_A298 Crystal Structure Of 2,5-diketo-d-gluconic Acid Red 6e-24
2ipj_A321 Crystal Structure Of H3alpha-Hydroxysteroid Dehydro 1e-23
1j96_A323 Human 3alpha-Hsd Type 3 In Ternary Complex With Nad 1e-23
1ihi_A323 Crystal Structure Of Human Type Iii 3-Alpha-Hydroxy 1e-23
1mrq_A323 Crystal Structure Of Human 20alpha-hsd In Ternary C 1e-23
1xjb_A325 Crystal Structure Of Human Type 3 3alpha-Hydroxyste 1e-23
3gug_A323 Crystal Structure Of Akr1c1 L308v Mutant In Complex 2e-23
3c3u_A323 Crystal Structure Of Akr1c1 In Complex With Nadp An 2e-23
1ah0_A316 Pig Aldose Reductase Complexed With Sorbinil Length 3e-23
1dla_A314 Novel Nadph-Binding Domain Revealed By The Crystal 3e-23
1eko_A315 Pig Aldose Reductase Complexed With Idd384 Inhibito 3e-23
2ipw_A315 Crystal Structure Of C298a W219y Aldose Reductase C 3e-23
3q67_A316 Human Aldose Reductase C298s Mutant In Complex With 1e-22
2pdx_A316 Human Aldose Reductase Double Mutant S302r-C303d Co 1e-22
2pdq_A316 Human Aldose Reductase Mutant C303d Complexed With 1e-22
2pd5_A316 Human Aldose Reductase Mutant V47i Complexed With Z 1e-22
1pwl_A316 Crystal Structure Of Human Aldose Reductase Complex 1e-22
3lz5_A316 Human Aldose Reductase Mutant T113v Complexed With 1e-22
3lqg_A316 Human Aldose Reductase Mutant T113a Complexed With 1e-22
2pdf_A316 Human Aldose Reductase Mutant L300p Complexed With 1e-22
2pdk_A316 Human Aldose Reductase Mutant L301m Complexed With 1e-22
2pdi_A316 Human Aldose Reductase Mutant L300a Complexed With 1e-22
2pdb_A316 Human Aldose Reductase Mutant F121p Complexed With 1e-22
1zua_X317 Crystal Structure Of Akr1b10 Complexed With Nadp+ A 1e-22
2pdm_A316 Human Aldose Reductase Mutant S302r Complexed With 1e-22
1el3_A316 Human Aldose Reductase Complexed With Idd384 Inhibi 1e-22
3ld5_A316 Human Aldose Reductase Mutant T113s Complexed With 1e-22
1abn_A315 The Crystal Structure Of The Aldose Reductase Nadph 1e-22
3onb_A315 Bond Breakage And Relocation Of A Covalently Bound 1e-22
3lbo_A316 Human Aldose Reductase Mutant T113c Complexed With 1e-22
2r24_A316 Human Aldose Reductase Structure Length = 316 1e-22
1ef3_A315 Fidarestat Bound To Human Aldose Reductase Length = 1e-22
2agt_A319 Aldose Reductase Mutant Leu 300 Pro Complexed With 1e-22
2acu_A315 Tyrosine-48 Is The Proton Donor And Histidine-110 D 1e-22
1z3n_A319 Human Aldose Reductase In Complex With Nadp+ And Th 1e-22
3rx2_A336 Crystal Structure Of Human Aldose Reductase Complex 2e-22
1c9w_A315 Cho Reductase With Nadp+ Length = 315 2e-22
2is7_A315 Crystal Structure Of Aldose Reductase Complexed Wit 2e-22
3qkz_A316 Crystal Structure Of Mutant His269arg Akr1b14 Lengt 2e-22
1mzr_A296 Structure Of Dkga From E.Coli At 2.13 A Resolution 2e-22
2ipf_A318 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 3e-22
2he5_A323 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 3e-22
1frb_A315 Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 3e-22
3cv6_A323 The Crystal Structure Of Mouse 17-Alpha Hydroxyster 3e-22
2ipg_A319 Crystal Structure Of 17alpha-Hydroxysteroid Dehydro 3e-22
3fjn_A323 The Crystal Structure Of 17-Alpha Hydroxysteroid De 3e-22
3o3r_A316 Crystal Structure Of Akr1b14 In Complex With Nadp L 9e-22
1xgd_A315 Apo R268a Human Aldose Reductase Length = 315 1e-21
2wzm_A283 Crystal Structure Of A Mycobacterium Aldo-Keto Redu 7e-21
1ral_A308 Three-Dimensional Structure Of Rat Liver 3alpha- Hy 3e-20
1lwi_A322 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FRO 3e-20
1afs_A323 Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydr 3e-20
1r38_A322 Crystal Structure Of H114a Mutant Of Candida Tenuis 4e-20
1jez_A322 The Structure Of Xylose Reductase, A Dimeric Aldo-K 4e-20
1z9a_A321 Crystal Structure Of The Asn-309 To Asp Mutant Of C 4e-20
1qwk_A317 Structural Genomics Of Caenorhabditis Elegans: Hypo 4e-20
1ye4_A322 Crystal Structure Of The Lys-274 To Arg Mutant Of C 6e-20
1sm9_A322 Crystal Structure Of An Engineered K274rn276d Doubl 6e-20
1hw6_A278 Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Red 1e-19
1a80_A277 Native 2,5-Diketo-D-Gluconic Acid Reductase A From 1e-19
3up8_A298 Crystal Structure Of A Putative 2,5-Diketo-D-Glucon 4e-19
1m9h_A278 Corynebacterium 2,5-dkgr A And Phe 22 Replaced With 3e-18
3krb_A334 Structure Of Aldose Reductase From Giardia Lamblia 1e-17
3ln3_A324 Crystal Structure Of Putative Reductase (Np_038806. 2e-15
>pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c9 Length = 335 Back     alignment and structure 
Iteration: 1

 Score =  274 bits (700), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 131/173 (75%), Positives = 146/173 (84%), Gaps = 3/173 (1%)
Query: 1   MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVH 60
           MEALYDSGKARAIGVSNFS KKL DLLE+AR+PPAVNQVECHP+W+QTKLQ FCKSKGVH
Sbjct: 163 MEALYDSGKARAIGVSNFSTKKLADLLELARVPPAVNQVECHPSWRQTKLQEFCKSKGVH 222
Query: 61  LSGYSPLGSAKNT---HRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEAR 117
           LS YSPLGS   T     VL+NPI+N VAEKLGKSPAQVALRWGLQMGHSVLPKS NE R
Sbjct: 223 LSAYSPLGSPGTTWLKSDVLKNPILNMVAEKLGKSPAQVALRWGLQMGHSVLPKSTNEGR 282
Query: 118 LKENFDIFDWYIPEDLLAKFPEIEQERLVKGAGFVHENFGIYRTLEELWDGEI 170
           +KENF++FDW IP+ + AKF EIEQ RLV G+  VHE    Y+++EELWDGEI
Sbjct: 283 IKENFNVFDWSIPDYMFAKFAEIEQARLVTGSFLVHETLSPYKSIEELWDGEI 335
>pdb|3H7R|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c8 Length = 331 Back     alignment and structure
>pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 Back     alignment and structure
>pdb|1ZGD|A Chain A, Chalcone Reductase Complexed With Nadp+ At 1.7 Angstrom Resolution Length = 312 Back     alignment and structure
>pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 Back     alignment and structure
>pdb|3F7J|A Chain A, B.Subtilis Yvgn Length = 276 Back     alignment and structure
>pdb|3D3F|A Chain A, Crystal Structure Of Yvgn And Cofactor Nadph From Bacillus Subtilis Length = 275 Back     alignment and structure
>pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 Back     alignment and structure
>pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 Back     alignment and structure
>pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 Back     alignment and structure
>pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 Back     alignment and structure
>pdb|2ALR|A Chain A, Aldehyde Reductase Length = 324 Back     alignment and structure
>pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 Back     alignment and structure
>pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 Back     alignment and structure
>pdb|3B3D|A Chain A, B.Subtilis Ytbe Length = 314 Back     alignment and structure
>pdb|1Q5M|A Chain A, Binary Complex Of Rabbit 20alpha-Hydroxysteroid Dehydrogenase With Nadph Length = 322 Back     alignment and structure
>pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 Back     alignment and structure
>pdb|1Q13|A Chain A, Crystal Structure Of Rabbit 20alpha Hyroxysteroid Dehydrogenase In Ternary Complex With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 Back     alignment and structure
>pdb|3BUR|A Chain A, Crystal Structure Of Delta(4)-3-Ketosteroid 5-Beta-Reductase In Complex With Nadp And Testosterone. Resolution: 1.62 A. Length = 326 Back     alignment and structure
>pdb|3CMF|A Chain A, Crystal Structure Of Human Liver 5beta-Reductase (Akr1d1) In Complex With Nadp And Cortisone. Resolution 1.90 A. Length = 346 Back     alignment and structure
>pdb|3UZW|A Chain A, Crystal Structure Of 5beta-Reductase (Akr1d1) E120h Mutant In Complex With Nadp+ Length = 346 Back     alignment and structure
>pdb|3UWE|A Chain A, Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length = 331 Back     alignment and structure
>pdb|1RY0|A Chain A, Structure Of Prostaglandin F Synthase With Prostaglandin D2 Length = 323 Back     alignment and structure
>pdb|1S1P|A Chain A, Crystal Structures Of Prostaglandin D2 11-Ketoreductase (Akr1c3) In Complex With The Non-Steroidal Anti- Inflammatory Drugs Flufenamic Acid And Indomethacin Length = 331 Back     alignment and structure
>pdb|3R43|A Chain A, Akr1c3 Complexed With Mefenamic Acid Length = 331 Back     alignment and structure
>pdb|2FVL|A Chain A, Crystal Structure Of Human 3-alpha Hydroxysteroid/dihydrodiol Dehydrogenase (akr1c4) Complexed With Nadp+ Length = 324 Back     alignment and structure
>pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 Back     alignment and structure
>pdb|2IPJ|A Chain A, Crystal Structure Of H3alpha-Hydroxysteroid Dehydrogenase Type 3 Mutant Y24a In Complex With Nadp+ And Epi-Testosterone Length = 321 Back     alignment and structure
>pdb|1J96|A Chain A, Human 3alpha-Hsd Type 3 In Ternary Complex With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|1IHI|A Chain A, Crystal Structure Of Human Type Iii 3-Alpha-Hydroxysteroid DehydrogenaseBILE ACID BINDING PROTEIN (AKR1C2) COMPLEXED With Nadp+ And Ursodeoxycholate Length = 323 Back     alignment and structure
>pdb|1MRQ|A Chain A, Crystal Structure Of Human 20alpha-hsd In Ternary Complex With Nadp And 20alpha-hydroxy-progesterone Length = 323 Back     alignment and structure
>pdb|1XJB|A Chain A, Crystal Structure Of Human Type 3 3alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp(H), Citrate And Acetate Molecules Length = 325 Back     alignment and structure
>pdb|3GUG|A Chain A, Crystal Structure Of Akr1c1 L308v Mutant In Complex With Nadp And 3,5-Dichlorosalicylic Acid Length = 323 Back     alignment and structure
>pdb|3C3U|A Chain A, Crystal Structure Of Akr1c1 In Complex With Nadp And 3,5- Dichlorosalicylic Acid Length = 323 Back     alignment and structure
>pdb|1AH0|A Chain A, Pig Aldose Reductase Complexed With Sorbinil Length = 316 Back     alignment and structure
>pdb|1DLA|A Chain A, Novel Nadph-Binding Domain Revealed By The Crystal Structure Of Aldose Reductase Length = 314 Back     alignment and structure
>pdb|1EKO|A Chain A, Pig Aldose Reductase Complexed With Idd384 Inhibitor Length = 315 Back     alignment and structure
>pdb|2IPW|A Chain A, Crystal Structure Of C298a W219y Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 Back     alignment and structure
>pdb|3Q67|A Chain A, Human Aldose Reductase C298s Mutant In Complex With Nadp+ In Space Group P212121 Length = 316 Back     alignment and structure
>pdb|2PDX|A Chain A, Human Aldose Reductase Double Mutant S302r-C303d Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|2PDQ|A Chain A, Human Aldose Reductase Mutant C303d Complexed With Uracil- Type Inhibitor. Length = 316 Back     alignment and structure
>pdb|2PD5|A Chain A, Human Aldose Reductase Mutant V47i Complexed With Zopolrestat Length = 316 Back     alignment and structure
>pdb|1PWL|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Nadp And Minalrestat Length = 316 Back     alignment and structure
>pdb|3LZ5|A Chain A, Human Aldose Reductase Mutant T113v Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|3LQG|A Chain A, Human Aldose Reductase Mutant T113a Complexed With Idd388 Length = 316 Back     alignment and structure
>pdb|2PDF|A Chain A, Human Aldose Reductase Mutant L300p Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|2PDK|A Chain A, Human Aldose Reductase Mutant L301m Complexed With Sorbinil. Length = 316 Back     alignment and structure
>pdb|2PDI|A Chain A, Human Aldose Reductase Mutant L300a Complexed With Zopolrestat At 1.55 A. Length = 316 Back     alignment and structure
>pdb|2PDB|A Chain A, Human Aldose Reductase Mutant F121p Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|1ZUA|X Chain X, Crystal Structure Of Akr1b10 Complexed With Nadp+ And Tolrestat Length = 317 Back     alignment and structure
>pdb|2PDM|A Chain A, Human Aldose Reductase Mutant S302r Complexed With Zopolrestat. Length = 316 Back     alignment and structure
>pdb|1EL3|A Chain A, Human Aldose Reductase Complexed With Idd384 Inhibitor Length = 316 Back     alignment and structure
>pdb|3LD5|A Chain A, Human Aldose Reductase Mutant T113s Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|1ABN|A Chain A, The Crystal Structure Of The Aldose Reductase Nadph Binary Complex Length = 315 Back     alignment and structure
>pdb|3ONB|A Chain A, Bond Breakage And Relocation Of A Covalently Bound Bromine Of Idd594 In A Complex With Har T113a Mutant After Extensive Radiation Dose Length = 315 Back     alignment and structure
>pdb|3LBO|A Chain A, Human Aldose Reductase Mutant T113c Complexed With Idd594 Length = 316 Back     alignment and structure
>pdb|2R24|A Chain A, Human Aldose Reductase Structure Length = 316 Back     alignment and structure
>pdb|1EF3|A Chain A, Fidarestat Bound To Human Aldose Reductase Length = 315 Back     alignment and structure
>pdb|2AGT|A Chain A, Aldose Reductase Mutant Leu 300 Pro Complexed With Fidarestat Length = 319 Back     alignment and structure
>pdb|2ACU|A Chain A, Tyrosine-48 Is The Proton Donor And Histidine-110 Directs Substrate Stereochemical Selectivity In The Reduction Reaction Of Human Aldose Reductase: Enzyme Kinetics And The Crystal Structure Of The Y48h Mutant Enzyme Length = 315 Back     alignment and structure
>pdb|1Z3N|A Chain A, Human Aldose Reductase In Complex With Nadp+ And The Inhibitor Lidorestat At 1.04 Angstrom Length = 319 Back     alignment and structure
>pdb|3RX2|A Chain A, Crystal Structure Of Human Aldose Reductase Complexed With Sulindac Sulfone Length = 336 Back     alignment and structure
>pdb|1C9W|A Chain A, Cho Reductase With Nadp+ Length = 315 Back     alignment and structure
>pdb|2IS7|A Chain A, Crystal Structure Of Aldose Reductase Complexed With Dichlorophenylacetic Acid Length = 315 Back     alignment and structure
>pdb|3QKZ|A Chain A, Crystal Structure Of Mutant His269arg Akr1b14 Length = 316 Back     alignment and structure
>pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 Back     alignment and structure
>pdb|2IPF|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Complex With Nadp+ And Epi-Testosterone Length = 318 Back     alignment and structure
>pdb|2HE5|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase In Binary Complex With Nadp(H) In An Open Conformation Length = 323 Back     alignment and structure
>pdb|1FRB|A Chain A, Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 Back     alignment and structure
>pdb|3CV6|A Chain A, The Crystal Structure Of Mouse 17-Alpha Hydroxysteroid Dehydrogenase Gg225.226pp Mutant In Complex With Inhibitor And Cofactor Nadp+. Length = 323 Back     alignment and structure
>pdb|2IPG|A Chain A, Crystal Structure Of 17alpha-Hydroxysteroid Dehydrogenase Mutant K31a In Complex With Nadp+ And Epi-Testosterone Length = 319 Back     alignment and structure
>pdb|3FJN|A Chain A, The Crystal Structure Of 17-Alpha Hydroxysteroid Dehydrogenase Y224d Mutant. Length = 323 Back     alignment and structure
>pdb|3O3R|A Chain A, Crystal Structure Of Akr1b14 In Complex With Nadp Length = 316 Back     alignment and structure
>pdb|1XGD|A Chain A, Apo R268a Human Aldose Reductase Length = 315 Back     alignment and structure
>pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 Back     alignment and structure
>pdb|1RAL|A Chain A, Three-Dimensional Structure Of Rat Liver 3alpha- Hydroxysteroid(Slash)dihydrodiol Dehydrogenase: A Member Of The Aldo-Keto Reductase Superfamily Length = 308 Back     alignment and structure
>pdb|1LWI|A Chain A, 3-Alpha-HydroxysteroidDIHYDRODIOL DEHYDROGENASE FROM Rattus Norvegicus Length = 322 Back     alignment and structure
>pdb|1AFS|A Chain A, Recombinant Rat Liver 3-Alpha-Hydroxysteroid Dehydrogenase (3-Alpha-Hsd) Complexed With Nadp And Testosterone Length = 323 Back     alignment and structure
>pdb|1R38|A Chain A, Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase Length = 322 Back     alignment and structure
>pdb|1JEZ|A Chain A, The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis Length = 322 Back     alignment and structure
>pdb|1Z9A|A Chain A, Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 321 Back     alignment and structure
>pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 Back     alignment and structure
>pdb|1YE4|A Chain A, Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 322 Back     alignment and structure
>pdb|1SM9|A Chain A, Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad Length = 322 Back     alignment and structure
>pdb|1HW6|A Chain A, Crystal Structure Of Apo-2,5-Diketo-D-Gluconate Reductase Length = 278 Back     alignment and structure
>pdb|1A80|A Chain A, Native 2,5-Diketo-D-Gluconic Acid Reductase A From Corynbacterium Sp. Complexed With Nadph Length = 277 Back     alignment and structure
>pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 Back     alignment and structure
>pdb|1M9H|A Chain A, Corynebacterium 2,5-dkgr A And Phe 22 Replaced With Tyr (f22y), Lys 232 Replaced With Gly (k232g), Arg 238 Replaced With His (r238h)and Ala 272 Replaced With Gly (a272g)in Presence Of Nadh Cofactor Length = 278 Back     alignment and structure
>pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 Back     alignment and structure
>pdb|3LN3|A Chain A, Crystal Structure Of Putative Reductase (Np_038806.2) From Mus Musculus At 1.18 A Resolution Length = 324 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query170
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 6e-98
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 2e-97
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 3e-91
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 5e-85
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 2e-79
2ao0_A324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 4e-79
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 6e-79
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 7e-79
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 1e-78
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 1e-77
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 6e-77
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 2e-76
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 9e-76
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 5e-62
4gie_A290 Prostaglandin F synthase; structural genomics, nia 1e-61
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 2e-61
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 3e-61
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 9e-61
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 2e-60
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 4e-60
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 7e-60
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 2e-59
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 3e-59
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 6e-58
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 4e-51
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 3e-15
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 6e-12
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 2e-11
3erp_A353 Putative oxidoreductase; funded by the national in 2e-10
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 4e-10
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 7e-10
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 1e-09
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 2e-09
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 4e-09
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 5e-09
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 8e-08
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 5e-07
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
 Score =  284 bits (730), Expect = 6e-98
 Identities = 123/173 (71%), Positives = 135/173 (78%), Gaps = 3/173 (1%)

Query: 1   MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVH 60
           MEALYDSGKARAIGVSNFS KKL DLL +AR+ PAVNQVECHP WQQ  L   CKSKGVH
Sbjct: 159 MEALYDSGKARAIGVSNFSSKKLTDLLNVARVTPAVNQVECHPVWQQQGLHELCKSKGVH 218

Query: 61  LSGYSPLGS---AKNTHRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEAR 117
           LSGYSPLGS    +   +VLQNPIV  VAEKLGK+ AQVALRWGLQ GHSVLPKS++ AR
Sbjct: 219 LSGYSPLGSQSKGEVRLKVLQNPIVTEVAEKLGKTTAQVALRWGLQTGHSVLPKSSSGAR 278

Query: 118 LKENFDIFDWYIPEDLLAKFPEIEQERLVKGAGFVHENFGIYRTLEELWDGEI 170
           LKEN D+FDW IPEDL  KF  I QE+  +   F HE  G Y+T+EELWDGEI
Sbjct: 279 LKENLDVFDWSIPEDLFTKFSNIPQEKFCRATEFAHETHGFYKTIEELWDGEI 331
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query170
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 100.0
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 100.0
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 100.0
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 100.0
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 100.0
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 100.0
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 100.0
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 100.0
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 100.0
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 100.0
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 100.0
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 100.0
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 100.0
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 100.0
3b3d_A314 YTBE protein, putative morphine dehydrogenase; ald 100.0
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 100.0
4gac_A324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 100.0
4gie_A290 Prostaglandin F synthase; structural genomics, nia 100.0
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 100.0
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 100.0
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 100.0
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 99.98
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 99.98
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 99.97
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 99.97
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 99.97
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 99.97
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 99.97
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 99.97
3erp_A353 Putative oxidoreductase; funded by the national in 99.97
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 99.97
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 99.97
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 99.97
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 99.96
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 99.96
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 99.96
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 99.96
4exb_A292 Putative uncharacterized protein; aldo-keto reduct 99.94
3cf4_A 807 Acetyl-COA decarboxylase/synthase alpha subunit; m 96.65
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
Probab=100.00  E-value=9e-38  Score=253.27  Aligned_cols=170  Identities=72%  Similarity=1.185  Sum_probs=156.5

Q ss_pred             ChhHhhcCCccEEEecCCcHHHHHHHHHhcCCCceEeccccCccCCcHHHHHHHHHcCcceEEecCCCCCCCC---CCCC
Q 030851            1 MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNT---HRVL   77 (170)
Q Consensus         1 L~~l~~~G~Ir~iGvS~~~~~~i~~~~~~~~~~~~~~q~~~n~~~~~~~~~~~~~~~gi~via~~~l~~gg~~---~~~~   77 (170)
                      |++|+++||||+||||||++++++++++.+.++|+++|++||++.++.+++++|+++||++++|+||++||..   ..++
T Consensus       159 L~~l~~~Gkir~iGvSn~~~~~l~~~~~~~~~~~~~~Q~~~~~~~~~~~l~~~~~~~gI~v~a~spL~~g~~~~~~~~~~  238 (331)
T 3h7r_A          159 MEALYDSGKARAIGVSNFSSKKLTDLLNVARVTPAVNQVECHPVWQQQGLHELCKSKGVHLSGYSPLGSQSKGEVRLKVL  238 (331)
T ss_dssp             HHHHHHTTSBSSEEEESCCHHHHHHHHHHCSSCCSEEEEECBTTBCCHHHHHHHHHHTCEEEEESTTSCSCTTTTTHHHH
T ss_pred             HHHHHHcCCCcEEEecCCCHHHHHHHHHhcCCCceeEEeecccccCCHHHHHHHHHCCCEEEEeCCCCCCCCCCCccchh
Confidence            5789999999999999999999999999999999999999999999999999999999999999999876421   1233


Q ss_pred             CcHHHHHHHHHhCCCHHHHHHHhhhcCCCEEeecCCCHHHHHHhhcccCCCCCHHHHHhchhhhccccccCCcccccccc
Q 030851           78 QNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQERLVKGAGFVHENFG  157 (170)
Q Consensus        78 ~~~~l~~~a~~~~~s~~qlal~~~l~~~~~~i~g~~~~~~l~enl~a~~~~L~~~~~~~l~~~~~~~~~~~~~~~~~~~~  157 (170)
                      ..+.+.++|+++|+|++|+||+|++++|+++|||+++++||++|+++++++||+++++.|+++.+.+.+.|..||.++.+
T Consensus       239 ~~~~l~~iA~~~g~t~aqvaL~w~l~~~~~vI~g~~~~~~l~en~~a~~~~L~~ee~~~l~~l~~~~~~~~~~~~~~~~~  318 (331)
T 3h7r_A          239 QNPIVTEVAEKLGKTTAQVALRWGLQTGHSVLPKSSSGARLKENLDVFDWSIPEDLFTKFSNIPQEKFCRATEFAHETHG  318 (331)
T ss_dssp             TCHHHHHHHHHHTCCHHHHHHHHHHHTTCEECCCCSCHHHHHHHTCCSSCCCCHHHHGGGGGSCCCCSCCCGGGCCTTTC
T ss_pred             cCHHHHHHHHHHCcCHHHHHHHHHHHCCCEEEeCCCCHHHHHHHHhhCCCCcCHHHHHHHHHhhhcCcccCcccccCCCC
Confidence            45789999999999999999999999999999999999999999999999999999999999999777777678888889


Q ss_pred             ccccccccccCCC
Q 030851          158 IYRTLEELWDGEI  170 (170)
Q Consensus       158 ~~~~~~~~~~~~~  170 (170)
                      ||++.+++|++|+
T Consensus       319 ~~~~~~~~~~~~~  331 (331)
T 3h7r_A          319 FYKTIEELWDGEI  331 (331)
T ss_dssp             SSCSHHHHTTTCC
T ss_pred             ccccchhhccccC
Confidence            9999999999986
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure
>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 170
d1s1pa_315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 1e-31
d1us0a_314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 4e-31
d1hqta_324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 2e-28
d1afsa_319 c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase 3e-28
d1mi3a_319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 3e-27
d1mzra_274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 8e-26
d1frba_315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 7e-24
d1vp5a_284 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 7e-24
d1hw6a_262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 2e-23
d1pyfa_311 c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu 7e-21
d1lqaa_346 c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 4e-20
d1qwka_312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 7e-18
d3eaua1326 c.1.7.1 (A:36-361) Voltage-dependent K+ channel be 5e-12
d1pz1a_333 c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu 3e-11
d1ur3m_298 c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc 4e-11
d1gvea_324 c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) 4e-08
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Prostaglandin d2 11-ketoreductase (akr1c3)
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  113 bits (283), Expect = 1e-31
 Identities = 56/163 (34%), Positives = 93/163 (57%), Gaps = 10/163 (6%)

Query: 1   MEALYDSGKARAIGVSNFSLKKLGDLLEIA--RIPPAVNQVECHPAWQQTKLQAFCKSKG 58
           ME   D+G A++IGVSNF+ ++L  +L     +  P  NQVECHP + ++KL  FCKSK 
Sbjct: 146 MEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKD 205

Query: 59  VHLSGYSPLGSAKNT-------HRVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPK 111
           + L  YS LGS ++          +L++P++  +A+K  ++PA +ALR+ LQ G  VL K
Sbjct: 206 IVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAK 265

Query: 112 SANEARLKENFDIFDWYIPEDLLAKFPEIEQE-RLVKGAGFVH 153
           S NE R+++N  +F++ +  + +     +++         F  
Sbjct: 266 SYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFAS 308
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1gvea_ c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 324 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query170
d1qwka_312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 99.97
d1afsa_319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 99.97
d1s1pa_315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 99.97
d1us0a_314 Aldose reductase (aldehyde reductase) {Human (Homo 99.97
d1hqta_324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 99.97
d1frba_315 FR-1 (fibroblast growth factor-induced) protein {M 99.96
d1mi3a_319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 99.96
d1hw6a_262 2,5-diketo-D-gluconic acid reductase A {Corynebact 99.96
d1mzra_274 2,5-diketo-D-gluconic acid reductase A {Escherichi 99.96
d1lqaa_346 Tas protein {Escherichia coli [TaxId: 562]} 99.96
d1pyfa_311 Putative oxidoreductase IolS {Bacillus subtilis [T 99.95
d1vp5a_284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 99.95
d1gvea_324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 99.94
d1pz1a_333 Putative oxidoreductase YhdN {Bacillus subtilis [T 99.94
d1ur3m_298 Hypothetical oxidoreductase YdhF {Escherichia coli 99.91
d3eaua1326 Voltage-dependent K+ channel beta subunit {Rat (Ra 99.89
d1dxea_253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 95.37
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Hypothetical protein C07D8.6
species: Nematode (Caenorhabditis elegans) [TaxId: 6239]

Probab=99.97  E-value=7.2e-31  Score=208.58  Aligned_cols=159  Identities=35%  Similarity=0.563  Sum_probs=140.1

Q ss_pred             ChhHhhcCCccEEEecCCcHHHHHHHHHhcCCCceEeccccCccCCcHHHHHHHHHcCcceEEecCCCCCCCCC------
Q 030851            1 MEALYDSGKARAIGVSNFSLKKLGDLLEIARIPPAVNQVECHPAWQQTKLQAFCKSKGVHLSGYSPLGSAKNTH------   74 (170)
Q Consensus         1 L~~l~~~G~Ir~iGvS~~~~~~i~~~~~~~~~~~~~~q~~~n~~~~~~~~~~~~~~~gi~via~~~l~~gg~~~------   74 (170)
                      |++++++|+||+||+|||+++.++++++.+.+.+..+|..++......+++++|+++||++++|+||++|+++.      
T Consensus       134 l~~l~~~G~ir~iG~Sn~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~a~spL~~g~~~~~~~~~~  213 (312)
T d1qwka_         134 FDAVYKAGLAKAVGVSNWNNDQISRALALGLTPVHNSQVELHLYFPQHDHVDFCKKHNISVTSYATLGSPGRVNFTLPTG  213 (312)
T ss_dssp             HHHHHHTTSBSSEEEESCCHHHHHHHHTTCSSCCCEEEEECBTTBCCHHHHHHHHHTTCEEEEESTTCSCCEECCBCTTC
T ss_pred             HHHHHhcCccccccccccchhHHHHHhhccccchhhhhhcchhhcccHHHHHHHHhcCccccccCcccccccccCCCCcc
Confidence            57899999999999999999999999999988888888888887777999999999999999999999885431      


Q ss_pred             ---------CCCCcHHHHHHHHHhCCCHHHHHHHhhhcCCCEEeecCCCHHHHHHhhcccCCCCCHHHHHhchhhhcccc
Q 030851           75 ---------RVLQNPIVNTVAEKLGKSPAQVALRWGLQMGHSVLPKSANEARLKENFDIFDWYIPEDLLAKFPEIEQERL  145 (170)
Q Consensus        75 ---------~~~~~~~l~~~a~~~~~s~~qlal~~~l~~~~~~i~g~~~~~~l~enl~a~~~~L~~~~~~~l~~~~~~~~  145 (170)
                               .....+.+.++|+++|+|++|+||+|++++++++|+|+++++||++|+++.+++||+++++.|+++.+..-
T Consensus       214 ~~~~~~~~~~~~~~~~l~~ia~~~~~t~aq~aL~w~l~~~~~vI~G~~~~~~l~en~~a~~~~Lt~e~~~~l~~~~~~~r  293 (312)
T d1qwka_         214 QKLDWAPAPSDLQDQNVLALAEKTHKTPAQVLLRYALDRGCAILPKSIQENRIKENFEVFDFSLTEEDIAKLEESKNSQR  293 (312)
T ss_dssp             CBCCCEECSSGGGCHHHHHHHHHHTCCHHHHHHHHHHHTTCEEECCCCSHHHHHHHHCCSSCCCCHHHHHHHTTTCCCCC
T ss_pred             chhccccccchhhHHHHHHHHHHcCCCHHHHHHHHHHHCCCEEEECCCCHHHHHHHHhhCCCCCCHHHHHHHhCcCcCCC
Confidence                     11123789999999999999999999999999999999999999999999999999999999999988655


Q ss_pred             ccCCccccc-ccccc
Q 030851          146 VKGAGFVHE-NFGIY  159 (170)
Q Consensus       146 ~~~~~~~~~-~~~~~  159 (170)
                      ...++|+.+ |.+||
T Consensus       294 ~~~~~~~~~~p~~~~  308 (312)
T d1qwka_         294 LFLQDFMTGHPEDAF  308 (312)
T ss_dssp             SCCCGGGTTCTTCTT
T ss_pred             cCCcccccCCCCCCC
Confidence            555588884 45777
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gvea_ c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure