Citrus Sinensis ID: 030852


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
MAAQNFLWSFTKNCFTFGLIGLTISDRYASIVPVRGSSMSPTFNLTTDSFMGSLSDDYVLVEKFCLQKYKFSHGDVIVFCSPSNHKEKHVKRIIGLPGDWIGTPMTNDVMKVPNGHCWVEGDNPSSSLDSRSFGPIPLGLIKGWVTHILWPPQRVRHIERKNHENILSPS
ccHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEECcccccccccccccccccccccccEEEEEEEEEEccccccccEEEEEccccccccEEEEEEEccccEEEcccccccEECccccEEEEccccccccccccccccccccEEEEEEEEEccccccccccccccccccccc
***QNFLWSFTKNCFTFGLIGLTISDRYASIVPVRGSSMSPTFNLTTDSFMGSLSDDYVLVEKFCLQKYKFSHGDVIVFCSPSNHKEKHVKRIIGLPGDWIGTPMTNDVMKVPNGHCWVEGDNPSSSLDSRSFGPIPLGLIKGWVTHILWPPQRVRHIER**********
xxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAQNFLWSFTKNCFTFGLIGLTISDRYASIVPVRGSSMSPTFNLTTDSFMGSLSDDYVLVEKFCLQKYKFSHGDVIVFCSPSNHKEKHVKRIIGLPGDWIGTPMTNDVMKVPNGHCWVEGDNPSSSLDSRSFGPIPLGLIKGWVTHILWPPQRVRHIERKNHENILSPS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial inner membrane protease subunit 2 Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. Known to process the nuclear encoded protein DIABLO.probableQ2KI92
Mitochondrial inner membrane protease subunit 2 Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. Known to process the nuclear encoded protein DIABLO.probableQ8BPT6
Mitochondrial inner membrane protease subunit 2 Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space.probableQ6AZD4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B12, chain A
Confidence level:very confident
Coverage over the Query: 25-45,56-153
View the alignment between query and template
View the model in PyMOL