Citrus Sinensis ID: 030856


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVASRQSFLNTSKWIDEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKSRELNVMFIETSAKAGFNIKGCSPTIRRLI
ccccccccEEcEEEEccccccHHHHHHHHccccccccccccccEEEEEEEEEEccEEEEEEEEEcccccccccccHHHHccccEEEEEEEccccHHHHcHHHHHHHHHHHcccccEEEEEEEcccccccccccHHHHHHHHHHccccEEEccccccccHHHHHHHHHHcc
*****ALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVASRQSFLNTSKWIDEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKSRELNVMFIETSAKAGFNIKGCSPTIRRLI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPVSALAKYKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVASRQSFLNTSKWIDEVRTERGSDVIIVLVGNKTDLVEKRQVSIEEGEAKSRELNVMFIETSAKAGFNIKGCSPTIRRLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related protein RABH1b Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER). Binds GTP and GDP and possesses intrinsic GTPase activity.confidentO80501
Ras-related protein Rab-6A Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER).probableQ1KME6
Ras-related protein Rab-6 Protein transport. Probably involved in vesicular traffic.probableQ55FK2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y8E, chain A
Confidence level:very confident
Coverage over the Query: 7-170
View the alignment between query and template
View the model in PyMOL