Citrus Sinensis ID: 030871
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 170 | ||||||
| 255578691 | 214 | glutathione-s-transferase theta, gst, pu | 0.982 | 0.780 | 0.766 | 5e-72 | |
| 388520051 | 215 | unknown [Lotus japonicus] | 0.988 | 0.781 | 0.732 | 1e-69 | |
| 356526968 | 216 | PREDICTED: glutathione S-transferase F10 | 0.988 | 0.777 | 0.732 | 3e-69 | |
| 158323772 | 216 | glutathione S-transferase 5 [Vitis vinif | 0.988 | 0.777 | 0.727 | 6e-69 | |
| 358248536 | 215 | glutathione S-transferase GST 22 [Glycin | 0.988 | 0.781 | 0.726 | 7e-69 | |
| 11385459 | 210 | glutathione S-transferase GST 22, partia | 0.988 | 0.8 | 0.726 | 8e-69 | |
| 225446791 | 216 | PREDICTED: glutathione S-transferase F9 | 0.988 | 0.777 | 0.733 | 9e-69 | |
| 217075676 | 215 | unknown [Medicago truncatula] | 0.988 | 0.781 | 0.726 | 9e-69 | |
| 351724749 | 215 | uncharacterized protein LOC100499911 [Gl | 0.988 | 0.781 | 0.720 | 1e-68 | |
| 388521717 | 215 | unknown [Medicago truncatula] | 0.988 | 0.781 | 0.726 | 1e-68 |
| >gi|255578691|ref|XP_002530205.1| glutathione-s-transferase theta, gst, putative [Ricinus communis] gi|223530281|gb|EEF32179.1| glutathione-s-transferase theta, gst, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 275 bits (703), Expect = 5e-72, Method: Compositional matrix adjust.
Identities = 128/167 (76%), Positives = 150/167 (89%)
Query: 1 MQPFGELPVIQDGDFILYESRAIMRYYAEKYRSQGTELLGKTIEERGLVEQWLEVEAHNY 60
+QPFG LPVIQDGD+ LYESRAI+RYYAEKY+SQGT+LLGKTIEERGLVEQWLEVEA NY
Sbjct: 47 LQPFGALPVIQDGDYTLYESRAIIRYYAEKYKSQGTDLLGKTIEERGLVEQWLEVEAQNY 106
Query: 61 NPAIYELTIQLLFSSKFGRPVDEKLVKESDEKLGKTLDVYEERLSKSKYLAGDFFSLADL 120
+P +Y +T+ +LF+S G DEKL+KES+EK+ K LD+YEERLSKSKYLAGDFFSLADL
Sbjct: 107 HPHVYNMTLHVLFASALGFTPDEKLIKESEEKIAKVLDIYEERLSKSKYLAGDFFSLADL 166
Query: 121 SHIPFTHYLVGPMGRQHMIRDRKHVSAWWDDISNRPSWKKVLELCKT 167
SH+PFT YLVGPM R+ MI+DRK+VSAWWDDIS+RPSWKKVLEL ++
Sbjct: 167 SHLPFTQYLVGPMKRECMIKDRKYVSAWWDDISSRPSWKKVLELYRS 213
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|388520051|gb|AFK48087.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|356526968|ref|XP_003532087.1| PREDICTED: glutathione S-transferase F10-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|158323772|gb|ABW34390.1| glutathione S-transferase 5 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|358248536|ref|NP_001239642.1| glutathione S-transferase GST 22 [Glycine max] gi|255625731|gb|ACU13210.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|11385459|gb|AAG34812.1|AF243377_1 glutathione S-transferase GST 22, partial [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225446791|ref|XP_002283209.1| PREDICTED: glutathione S-transferase F9 [Vitis vinifera] gi|302143519|emb|CBI22080.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|217075676|gb|ACJ86198.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|351724749|ref|NP_001237836.1| uncharacterized protein LOC100499911 [Glycine max] gi|255627605|gb|ACU14147.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388521717|gb|AFK48920.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 170 | ||||||
| TAIR|locus:2052811 | 215 | GSTF9 "AT2G30860" [Arabidopsis | 0.952 | 0.753 | 0.660 | 3.5e-59 | |
| TAIR|locus:2052826 | 215 | GSTF10 "AT2G30870" [Arabidopsi | 0.947 | 0.748 | 0.658 | 2.5e-58 | |
| TAIR|locus:2097730 | 214 | GSTF11 "AT3G03190" [Arabidopsi | 0.952 | 0.757 | 0.5 | 5.9e-41 | |
| TAIR|locus:2167215 | 214 | GSTF12 "AT5G17220" [Arabidopsi | 0.958 | 0.761 | 0.466 | 2.3e-39 | |
| TAIR|locus:2081695 | 219 | ATGSTF13 "AT3G62760" [Arabidop | 0.941 | 0.730 | 0.481 | 3e-37 | |
| TAIR|locus:2043298 | 263 | GSTF8 "AT2G47730" [Arabidopsis | 0.970 | 0.627 | 0.425 | 1.5e-33 | |
| TAIR|locus:2024690 | 208 | GSTF6 "AT1G02930" [Arabidopsis | 0.929 | 0.759 | 0.418 | 6.9e-31 | |
| TAIR|locus:2056685 | 212 | GSTF3 "AT2G02930" [Arabidopsis | 0.935 | 0.75 | 0.417 | 8.8e-31 | |
| TAIR|locus:2132308 | 212 | GSTF2 "AT4G02520" [Arabidopsis | 0.929 | 0.745 | 0.419 | 8.8e-31 | |
| TAIR|locus:2024700 | 209 | GSTF7 "AT1G02920" [Arabidopsis | 0.935 | 0.760 | 0.425 | 1.4e-30 |
| TAIR|locus:2052811 GSTF9 "AT2G30860" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 607 (218.7 bits), Expect = 3.5e-59, P = 3.5e-59
Identities = 107/162 (66%), Positives = 136/162 (83%)
Query: 1 MQPFGELPVIQDGDFILYESRAIMRYYAEKYRSQGTELLGKTIEERGLVEQWLEVEAHNY 60
+QPFG +P + DGD+ ++ESRA+MRY AEKYRSQG +LLGKT+E+RG VEQWL+VEA Y
Sbjct: 47 LQPFGTVPAVVDGDYKIFESRAVMRYVAEKYRSQGPDLLGKTVEDRGQVEQWLDVEATTY 106
Query: 61 NPAIYELTIQLLFSSKFGRPVDEKLVKESDEKLGKTLDVYEERLSKSKYLAGDFFSLADL 120
+P + LT+ ++F+S G P DEKL+KES+EKL LDVYE LSKSKYLAGDF SLADL
Sbjct: 107 HPPLLNLTLHIMFASVMGFPSDEKLIKESEEKLAGVLDVYEAHLSKSKYLAGDFVSLADL 166
Query: 121 SHIPFTHYLVGPMGRQHMIRDRKHVSAWWDDISNRPSWKKVL 162
+H+PFT YLVGP+G+ +MI+DRKHVSAWWDDIS+RP+WK+ +
Sbjct: 167 AHLPFTDYLVGPIGKAYMIKDRKHVSAWWDDISSRPAWKETV 208
|
|
| TAIR|locus:2052826 GSTF10 "AT2G30870" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2097730 GSTF11 "AT3G03190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167215 GSTF12 "AT5G17220" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2081695 ATGSTF13 "AT3G62760" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043298 GSTF8 "AT2G47730" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024690 GSTF6 "AT1G02930" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2056685 GSTF3 "AT2G02930" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2132308 GSTF2 "AT4G02520" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024700 GSTF7 "AT1G02920" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 170 | |||
| PLN02395 | 215 | PLN02395, PLN02395, glutathione S-transferase | 1e-106 | |
| cd03187 | 118 | cd03187, GST_C_Phi, C-terminal, alpha helical doma | 2e-64 | |
| PLN02473 | 214 | PLN02473, PLN02473, glutathione S-transferase | 4e-60 | |
| COG0625 | 211 | COG0625, Gst, Glutathione S-transferase [Posttrans | 2e-19 | |
| pfam00043 | 92 | pfam00043, GST_C, Glutathione S-transferase, C-ter | 1e-14 | |
| cd00299 | 100 | cd00299, GST_C_family, C-terminal, alpha helical d | 2e-13 | |
| cd03053 | 76 | cd03053, GST_N_Phi, GST_N family, Class Phi subfam | 2e-13 | |
| cd03181 | 123 | cd03181, GST_C_EF1Bgamma_like, Glutathione S-trans | 4e-13 | |
| cd03178 | 110 | cd03178, GST_C_Ure2p_like, C-terminal, alpha helic | 1e-11 | |
| cd03182 | 116 | cd03182, GST_C_GTT2_like, C-terminal, alpha helica | 9e-10 | |
| cd03180 | 110 | cd03180, GST_C_2, C-terminal, alpha helical domain | 1e-09 | |
| cd03207 | 101 | cd03207, GST_C_8, C-terminal, alpha helical domain | 1e-09 | |
| cd10294 | 123 | cd10294, GST_C_ValRS_N, Glutathione S-transferase | 3e-08 | |
| cd03050 | 76 | cd03050, GST_N_Theta, GST_N family, Class Theta su | 6e-08 | |
| cd03047 | 73 | cd03047, GST_N_2, GST_N family, unknown subfamily | 3e-07 | |
| cd00570 | 71 | cd00570, GST_N_family, Glutathione S-transferase ( | 2e-06 | |
| cd03046 | 76 | cd03046, GST_N_GTT1_like, GST_N family, Saccharomy | 2e-06 | |
| cd10291 | 110 | cd10291, GST_C_YfcG_like, C-terminal, alpha helica | 2e-06 | |
| pfam13410 | 69 | pfam13410, GST_C_2, Glutathione S-transferase, C-t | 3e-06 | |
| cd03076 | 73 | cd03076, GST_N_Pi, GST_N family, Class Pi subfamil | 9e-06 | |
| PRK11752 | 264 | PRK11752, PRK11752, putative S-transferase; Provis | 2e-05 | |
| cd03039 | 72 | cd03039, GST_N_Sigma_like, GST_N family, Class Sig | 2e-05 | |
| cd10293 | 117 | cd10293, GST_C_Ure2p, C-terminal, alpha helical do | 4e-05 | |
| cd10292 | 118 | cd10292, GST_C_YghU_like, C-terminal, alpha helica | 5e-05 | |
| cd03183 | 126 | cd03183, GST_C_Theta, C-terminal, alpha helical do | 7e-05 | |
| cd03056 | 73 | cd03056, GST_N_4, GST_N family, unknown subfamily | 2e-04 | |
| cd03059 | 73 | cd03059, GST_N_SspA, GST_N family, Stringent starv | 2e-04 | |
| pfam13417 | 75 | pfam13417, GST_N_3, Glutathione S-transferase, N-t | 5e-04 | |
| PTZ00057 | 205 | PTZ00057, PTZ00057, glutathione s-transferase; Pro | 6e-04 | |
| cd03177 | 117 | cd03177, GST_C_Delta_Epsilon, C-terminal, alpha he | 6e-04 | |
| pfam02798 | 74 | pfam02798, GST_N, Glutathione S-transferase, N-ter | 0.001 | |
| cd03189 | 123 | cd03189, GST_C_GTT1_like, C-terminal, alpha helica | 0.001 | |
| cd03048 | 81 | cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-lik | 0.002 | |
| cd10305 | 101 | cd10305, GST_C_AIMP3, Glutathione S-transferase C- | 0.003 | |
| cd03190 | 142 | cd03190, GST_C_Omega_like, C-terminal, alpha helic | 0.004 |
| >gnl|CDD|166036 PLN02395, PLN02395, glutathione S-transferase | Back alignment and domain information |
|---|
Score = 301 bits (773), Expect = e-106
Identities = 118/168 (70%), Positives = 144/168 (85%)
Query: 1 MQPFGELPVIQDGDFILYESRAIMRYYAEKYRSQGTELLGKTIEERGLVEQWLEVEAHNY 60
+QPFG +PVI DGD+ ++ESRAIMRYYAEKYRSQG +LLGKTIEERG VEQWL+VEA +Y
Sbjct: 47 LQPFGVVPVIVDGDYKIFESRAIMRYYAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSY 106
Query: 61 NPAIYELTIQLLFSSKFGRPVDEKLVKESDEKLGKTLDVYEERLSKSKYLAGDFFSLADL 120
+P + LT+ +LF+SK G P DEK++KES+EKL K LDVYE RLSKSKYLAGDF SLADL
Sbjct: 107 HPPLLNLTLHILFASKMGFPADEKVIKESEEKLAKVLDVYEARLSKSKYLAGDFVSLADL 166
Query: 121 SHIPFTHYLVGPMGRQHMIRDRKHVSAWWDDISNRPSWKKVLELCKTP 168
+H+PFT YLVGP+G+ ++I+DRKHVSAWWDDIS+RP+WK+VL P
Sbjct: 167 AHLPFTEYLVGPIGKAYLIKDRKHVSAWWDDISSRPAWKEVLAKYSLP 214
|
Length = 215 |
| >gnl|CDD|198296 cd03187, GST_C_Phi, C-terminal, alpha helical domain of Class Phi Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|166114 PLN02473, PLN02473, glutathione S-transferase | Back alignment and domain information |
|---|
| >gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family | Back alignment and domain information |
|---|
| >gnl|CDD|239351 cd03053, GST_N_Phi, GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198290 cd03181, GST_C_EF1Bgamma_like, Glutathione S-transferase C-terminal-like, alpha helical domain of the Gamma subunit of Elongation Factor 1B and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198288 cd03178, GST_C_Ure2p_like, C-terminal, alpha helical domain of Ure2p and related Glutathione S-transferase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198291 cd03182, GST_C_GTT2_like, C-terminal, alpha helical domain of GTT2-like Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|198289 cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|198316 cd03207, GST_C_8, C-terminal, alpha helical domain of an unknown subfamily 8 of Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|198327 cd10294, GST_C_ValRS_N, Glutathione S-transferase C-terminal-like, alpha helical domain of vertebrate Valyl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|239348 cd03050, GST_N_Theta, GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >gnl|CDD|239345 cd03047, GST_N_2, GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|239344 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >gnl|CDD|198324 cd10291, GST_C_YfcG_like, C-terminal, alpha helical domain of Escherichia coli YfcG Glutathione S-transferases and related uncharacterized proteins | Back alignment and domain information |
|---|
| >gnl|CDD|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|239374 cd03076, GST_N_Pi, GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >gnl|CDD|183298 PRK11752, PRK11752, putative S-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239337 cd03039, GST_N_Sigma_like, GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >gnl|CDD|198326 cd10293, GST_C_Ure2p, C-terminal, alpha helical domain of fungal Ure2p Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|198325 cd10292, GST_C_YghU_like, C-terminal, alpha helical domain of Escherichia coli Yghu Glutathione S-transferases and related uncharacterized proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198292 cd03183, GST_C_Theta, C-terminal, alpha helical domain of Class Theta Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|239354 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|239357 cd03059, GST_N_SspA, GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|173353 PTZ00057, PTZ00057, glutathione s-transferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|198287 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha helical domain of Class Delta and Epsilon Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|217234 pfam02798, GST_N, Glutathione S-transferase, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|198298 cd03189, GST_C_GTT1_like, C-terminal, alpha helical domain of GTT1-like Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|239346 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >gnl|CDD|198338 cd10305, GST_C_AIMP3, Glutathione S-transferase C-terminal-like, alpha helical domain of Aminoacyl tRNA synthetase complex-Interacting Multifunctional Protein 3 | Back alignment and domain information |
|---|
| >gnl|CDD|198299 cd03190, GST_C_Omega_like, C-terminal, alpha helical domain of Class Omega-like Glutathione S-transferases | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 170 | |||
| PLN02395 | 215 | glutathione S-transferase | 100.0 | |
| PLN02473 | 214 | glutathione S-transferase | 100.0 | |
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 99.97 | |
| PRK10542 | 201 | glutathionine S-transferase; Provisional | 99.97 | |
| TIGR01262 | 210 | maiA maleylacetoacetate isomerase. Maleylacetoacet | 99.96 | |
| PRK13972 | 215 | GSH-dependent disulfide bond oxidoreductase; Provi | 99.96 | |
| PRK15113 | 214 | glutathione S-transferase; Provisional | 99.96 | |
| PRK11752 | 264 | putative S-transferase; Provisional | 99.95 | |
| COG0625 | 211 | Gst Glutathione S-transferase [Posttranslational m | 99.95 | |
| PRK10357 | 202 | putative glutathione S-transferase; Provisional | 99.95 | |
| PTZ00057 | 205 | glutathione s-transferase; Provisional | 99.95 | |
| KOG0406 | 231 | consensus Glutathione S-transferase [Posttranslati | 99.95 | |
| KOG0867 | 226 | consensus Glutathione S-transferase [Posttranslati | 99.95 | |
| KOG1695 | 206 | consensus Glutathione S-transferase [Posttranslati | 99.93 | |
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 99.93 | |
| PLN02378 | 213 | glutathione S-transferase DHAR1 | 99.92 | |
| PLN02817 | 265 | glutathione dehydrogenase (ascorbate) | 99.91 | |
| KOG0868 | 217 | consensus Glutathione S-transferase [Posttranslati | 99.9 | |
| PRK10387 | 210 | glutaredoxin 2; Provisional | 99.9 | |
| PLN02907 | 722 | glutamate-tRNA ligase | 99.87 | |
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 99.87 | |
| KOG4420 | 325 | consensus Uncharacterized conserved protein (Gangl | 99.82 | |
| cd03187 | 118 | GST_C_Phi GST_C family, Class Phi subfamily; compo | 99.8 | |
| cd03196 | 115 | GST_C_5 GST_C family, unknown subfamily 5; compose | 99.76 | |
| cd03188 | 114 | GST_C_Beta GST_C family, Class Beta subfamily; GST | 99.74 | |
| cd03178 | 113 | GST_C_Ure2p_like GST_C family, Ure2p-like subfamil | 99.74 | |
| cd03186 | 107 | GST_C_SspA GST_N family, Stringent starvation prot | 99.73 | |
| cd03190 | 142 | GST_C_ECM4_like GST_C family, ECM4-like subfamily; | 99.72 | |
| cd03183 | 126 | GST_C_Theta GST_C family, Class Theta subfamily; c | 99.72 | |
| KOG4244 | 281 | consensus Failed axon connections (fax) protein/gl | 99.71 | |
| cd03189 | 119 | GST_C_GTT1_like GST_C family, Saccharomyces cerevi | 99.71 | |
| cd03185 | 126 | GST_C_Tau GST_C family, Class Tau subfamily; GSTs | 99.7 | |
| cd03181 | 123 | GST_C_EFB1gamma GST_C family, Gamma subunit of Elo | 99.69 | |
| cd03180 | 110 | GST_C_2 GST_C family, unknown subfamily 2; compose | 99.69 | |
| cd03182 | 117 | GST_C_GTT2_like GST_C family, Saccharomyces cerevi | 99.69 | |
| cd03209 | 121 | GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar | 99.68 | |
| cd03191 | 121 | GST_C_Zeta GST_C family, Class Zeta subfamily; GST | 99.68 | |
| cd03177 | 118 | GST_C_Delta_Epsilon GST_C family, Class Delta and | 99.67 | |
| cd03208 | 137 | GST_C_Alpha GST_C family, Class Alpha subfamily; G | 99.66 | |
| cd03210 | 126 | GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar | 99.65 | |
| cd03184 | 124 | GST_C_Omega GST_C family, Class Omega subfamily; G | 99.65 | |
| cd03207 | 103 | GST_C_8 GST_C family, unknown subfamily 8; compose | 99.6 | |
| COG0435 | 324 | ECM4 Predicted glutathione S-transferase [Posttran | 99.59 | |
| KOG3027 | 257 | consensus Mitochondrial outer membrane protein Met | 99.59 | |
| cd03200 | 96 | GST_C_JTV1 GST_C family, JTV-1 subfamily; composed | 99.59 | |
| cd03198 | 134 | GST_C_CLIC GST_C family, Chloride Intracellular Ch | 99.59 | |
| PF00043 | 95 | GST_C: Glutathione S-transferase, C-terminal domai | 99.58 | |
| cd03195 | 114 | GST_C_4 GST_C family, unknown subfamily 4; compose | 99.58 | |
| KOG1422 | 221 | consensus Intracellular Cl- channel CLIC, contains | 99.57 | |
| PF13410 | 69 | GST_C_2: Glutathione S-transferase, C-terminal dom | 99.56 | |
| cd03179 | 105 | GST_C_1 GST_C family, unknown subfamily 1; compose | 99.56 | |
| cd03203 | 120 | GST_C_Lambda GST_C family, Class Lambda subfamily; | 99.56 | |
| cd03206 | 100 | GST_C_7 GST_C family, unknown subfamily 7; compose | 99.55 | |
| cd03194 | 114 | GST_C_3 GST_C family, unknown subfamily 3; compose | 99.54 | |
| cd03204 | 111 | GST_C_GDAP1 GST_C family, Ganglioside-induced diff | 99.54 | |
| cd03201 | 121 | GST_C_DHAR GST_C family, Dehydroascorbate Reductas | 99.47 | |
| KOG2903 | 319 | consensus Predicted glutathione S-transferase [Pos | 99.44 | |
| cd00299 | 100 | GST_C_family Glutathione S-transferase (GST) famil | 99.43 | |
| cd03202 | 124 | GST_C_etherase_LigE GST_C family, Beta etherase Li | 99.42 | |
| cd03192 | 104 | GST_C_Sigma_like GST_C family, Class Sigma_like; c | 99.39 | |
| cd03211 | 126 | GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me | 99.38 | |
| PF14497 | 99 | GST_C_3: Glutathione S-transferase, C-terminal dom | 99.35 | |
| cd03193 | 88 | GST_C_Metaxin GST_C family, Metaxin subfamily; com | 99.32 | |
| cd03212 | 137 | GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, | 99.23 | |
| cd03205 | 98 | GST_C_6 GST_C family, unknown subfamily 6; compose | 99.18 | |
| cd03197 | 149 | GST_C_mPGES2 GST_C family; microsomal Prostaglandi | 99.17 | |
| COG2999 | 215 | GrxB Glutaredoxin 2 [Posttranslational modificatio | 99.15 | |
| KOG3028 | 313 | consensus Translocase of outer mitochondrial membr | 99.1 | |
| KOG3029 | 370 | consensus Glutathione S-transferase-related protei | 99.08 | |
| PF14834 | 117 | GST_C_4: Glutathione S-transferase, C-terminal dom | 99.07 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 98.91 | |
| cd03046 | 76 | GST_N_GTT1_like GST_N family, Saccharomyces cerevi | 98.91 | |
| cd03080 | 75 | GST_N_Metaxin_like GST_N family, Metaxin subfamily | 98.9 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 98.89 | |
| cd03050 | 76 | GST_N_Theta GST_N family, Class Theta subfamily; c | 98.89 | |
| cd03075 | 82 | GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar | 98.88 | |
| cd03052 | 73 | GST_N_GDAP1 GST_N family, Ganglioside-induced diff | 98.86 | |
| cd03057 | 77 | GST_N_Beta GST_N family, Class Beta subfamily; GST | 98.85 | |
| cd03048 | 81 | GST_N_Ure2p_like GST_N family, Ure2p-like subfamil | 98.84 | |
| cd03076 | 73 | GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar | 98.84 | |
| cd03077 | 79 | GST_N_Alpha GST_N family, Class Alpha subfamily; G | 98.83 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 98.81 | |
| cd03038 | 84 | GST_N_etherase_LigE GST_N family, Beta etherase Li | 98.79 | |
| cd03053 | 76 | GST_N_Phi GST_N family, Class Phi subfamily; compo | 98.77 | |
| PF13409 | 70 | GST_N_2: Glutathione S-transferase, N-terminal dom | 98.77 | |
| cd03039 | 72 | GST_N_Sigma_like GST_N family, Class Sigma_like; c | 98.75 | |
| cd03058 | 74 | GST_N_Tau GST_N family, Class Tau subfamily; GSTs | 98.74 | |
| cd03047 | 73 | GST_N_2 GST_N family, unknown subfamily 2; compose | 98.73 | |
| cd03079 | 74 | GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me | 98.72 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 98.72 | |
| PF02798 | 76 | GST_N: Glutathione S-transferase, N-terminal domai | 98.72 | |
| cd03043 | 73 | GST_N_1 GST_N family, unknown subfamily 1; compose | 98.66 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 98.65 | |
| cd03044 | 75 | GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo | 98.63 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 98.6 | |
| cd03042 | 73 | GST_N_Zeta GST_N family, Class Zeta subfamily; GST | 98.58 | |
| cd03054 | 72 | GST_N_Metaxin GST_N family, Metaxin subfamily; com | 98.56 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 98.5 | |
| PF04399 | 132 | Glutaredoxin2_C: Glutaredoxin 2, C terminal domain | 98.46 | |
| cd03049 | 73 | GST_N_3 GST_N family, unknown subfamily 3; compose | 98.42 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 98.4 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 98.4 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 98.4 | |
| cd03078 | 73 | GST_N_Metaxin1_like GST_N family, Metaxin subfamil | 98.2 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 98.19 | |
| cd03199 | 128 | GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub | 98.19 | |
| KOG1147 | 712 | consensus Glutamyl-tRNA synthetase [Translation, r | 97.82 | |
| PF10568 | 72 | Tom37: Outer mitochondrial membrane transport comp | 97.36 | |
| PF11801 | 168 | Tom37_C: Tom37 C-terminal domain; InterPro: IPR019 | 94.94 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 94.41 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 92.03 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 87.54 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 86.19 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 85.83 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 83.32 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 80.38 | |
| PF09635 | 122 | MetRS-N: MetRS-N binding domain; InterPro: IPR0182 | 80.36 |
| >PLN02395 glutathione S-transferase | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.7e-32 Score=189.39 Aligned_cols=167 Identities=70% Similarity=1.211 Sum_probs=133.7
Q ss_pred CCCCCCCCeeEeCCeEEeehHHHHHHHHHHhccCCCCCCCCCHHHHHHHHHHHHHHHhhhchHHHHHHHHHHhhcccCCC
Q 030871 1 MQPFGELPVIQDGDFILYESRAIMRYYAEKYRSQGTELLGKTIEERGLVEQWLEVEAHNYNPAIYELTIQLLFSSKFGRP 80 (170)
Q Consensus 1 ~~P~g~vP~l~~~~~~i~es~~I~~yl~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 80 (170)
+||+|+||+|+++|.+|+||.+|++||+++++..+..++|.++.++++++.|+.+.+..+...+........+....+..
T Consensus 47 ~nP~g~vP~L~~~~~~l~ES~aI~~YL~~~~~~~~~~l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 126 (215)
T PLN02395 47 LQPFGVVPVIVDGDYKIFESRAIMRYYAEKYRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLNLTLHILFASKMGFP 126 (215)
T ss_pred hCCCCCCCEEEECCEEEEcHHHHHHHHHHHcCCCCcCcCCCChhHHHHHHHHHHHHHHhcCchHHHHHHHHHhhhhccCC
Confidence 59999999999999999999999999999997533458899999999999999998877765544433322222222223
Q ss_pred CCHHHHHHHHHHHHHHHHHHHHHhcCCCcccCCCccHhhhhhhhhHhhhcCCcc-ccccccCCccHHHHHHHHhcChhHH
Q 030871 81 VDEKLVKESDEKLGKTLDVYEERLSKSKYLAGDFFSLADLSHIPFTHYLVGPMG-RQHMIRDRKHVSAWWDDISNRPSWK 159 (170)
Q Consensus 81 ~~~~~~~~~~~~~~~~l~~le~~L~~~~fl~G~~~t~aDi~l~~~l~~~~~~~~-~~~~~~~~p~l~~w~~~~~~~p~~~ 159 (170)
...+..+...+.+.+.++.||+.|++++|++|+++|+|||++++++.++..... .... ..+|+|.+|+++|.++|+++
T Consensus 127 ~~~~~~~~~~~~~~~~l~~le~~L~~~~~l~G~~~s~ADi~l~~~~~~~~~~~~~~~~~-~~~p~L~~w~~~~~~rp~~k 205 (215)
T PLN02395 127 ADEKVIKESEEKLAKVLDVYEARLSKSKYLAGDFVSLADLAHLPFTEYLVGPIGKAYLI-KDRKHVSAWWDDISSRPAWK 205 (215)
T ss_pred CcHHHHHHHHHHHHHHHHHHHHHhcCCccccCCCcCHHHHHHHHHHHHHhcccchhhhh-ccCchHHHHHHHHHcChHHH
Confidence 334455667888899999999999999999999999999999998877643211 2234 77899999999999999999
Q ss_pred HHHHhcCCC
Q 030871 160 KVLELCKTP 168 (170)
Q Consensus 160 ~~~~~~~~~ 168 (170)
+++++++.|
T Consensus 206 ~~~~~~~~~ 214 (215)
T PLN02395 206 EVLAKYSLP 214 (215)
T ss_pred HHHHHhcCC
Confidence 999998887
|
|
| >PLN02473 glutathione S-transferase | Back alignment and domain information |
|---|
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >PRK10542 glutathionine S-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01262 maiA maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK15113 glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >PRK11752 putative S-transferase; Provisional | Back alignment and domain information |
|---|
| >COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10357 putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00057 glutathione s-transferase; Provisional | Back alignment and domain information |
|---|
| >KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1695 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
| >PLN02378 glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >PLN02817 glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >KOG0868 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10387 glutaredoxin 2; Provisional | Back alignment and domain information |
|---|
| >PLN02907 glutamate-tRNA ligase | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown] | Back alignment and domain information |
|---|
| >cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 | Back alignment and domain information |
|---|
| >cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3027 consensus Mitochondrial outer membrane protein Metaxin 2, Metaxin 1-binding protein [Cell wall/membrane/envelope biogenesis; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene | Back alignment and domain information |
|---|
| >cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins | Back alignment and domain information |
|---|
| >PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B | Back alignment and domain information |
|---|
| >cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs | Back alignment and domain information |
|---|
| >cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant | Back alignment and domain information |
|---|
| >KOG2903 consensus Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha | Back alignment and domain information |
|---|
| >cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B | Back alignment and domain information |
|---|
| >cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins | Back alignment and domain information |
|---|
| >cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3028 consensus Translocase of outer mitochondrial membrane complex, subunit TOM37/Metaxin 1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B | Back alignment and domain information |
|---|
| >cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >KOG1147 consensus Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space | Back alignment and domain information |
|---|
| >PF11801 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >PF09635 MetRS-N: MetRS-N binding domain; InterPro: IPR018285 This entry represents the N-terminal domain of methionyl-tRNA synthetase (MetRS) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 170 | ||||
| 1aw9_A | 216 | Structure Of Glutathione S-Transferase Iii In Apo F | 5e-35 | ||
| 1bye_A | 213 | Glutathione S-Transferase I From Mais In Complex Wi | 2e-34 | ||
| 1axd_A | 209 | Structure Of Glutathione S-transferase-i Bound With | 5e-34 | ||
| 1gnw_A | 211 | Structure Of Glutathione S-Transferase Length = 211 | 4e-33 | ||
| 3lsz_A | 225 | Crystal Structure Of Glutathione S-Transferase From | 9e-10 | ||
| 4iel_A | 229 | Crystal Structure Of A Glutathione S-Transferase Fa | 7e-09 | ||
| 3lq7_A | 240 | Crystal Structure Of Glutathione S-Transferase From | 6e-08 | ||
| 2ycd_A | 230 | Structure Of A Novel Glutathione Transferase From A | 7e-08 | ||
| 3ay8_A | 216 | Glutathione S-Transferase Unclassified 2 From Bomby | 7e-08 | ||
| 2c3n_A | 247 | Human Glutathione-S-Transferase T1-1, Apo Form Leng | 3e-07 | ||
| 2c3q_A | 247 | Human Glutathione-S-Transferase T1-1 W234r Mutant, | 4e-07 | ||
| 3m3m_A | 210 | Crystal Structure Of Glutathione S-Transferase From | 4e-07 | ||
| 1jlv_A | 209 | Anopheles Dirus Species B Glutathione S-transferase | 5e-07 | ||
| 4eci_A | 244 | Crystal Structure Of Glutathione S-Transferase Prk1 | 9e-07 | ||
| 3vk9_A | 216 | Crystal Structure Of Delta-Class Glutathione Transf | 3e-06 | ||
| 3i69_A | 222 | Apo Glutathione Transferase A1-1 Gimf-Helix Mutant | 9e-06 | ||
| 1tdi_A | 222 | Crystal Structure Of Hgsta3-3 In Complex With Gluta | 2e-05 | ||
| 3f6f_A | 210 | Crystal Structure Of Glutathione Transferase Dmgstd | 2e-05 | ||
| 1ljr_A | 244 | Glutathione Transferase (Hgst T2-2) From Human Leng | 3e-05 | ||
| 3qav_A | 243 | Crystal Structure Of A Glutathione S-transferase Fr | 4e-05 | ||
| 1pn9_A | 209 | Crystal Structure Of An Insect Delta-class Glutathi | 4e-05 | ||
| 4hz2_A | 230 | Crystal Structure Of Glutathione S-Transferase Xaut | 4e-05 | ||
| 1v2a_A | 210 | Glutathione S-transferase 1-6 From Anopheles Dirus | 5e-05 | ||
| 4hoj_A | 210 | Crystal Structure Of Glutathione Transferase Homolo | 8e-05 | ||
| 2vct_A | 222 | Glutathione Transferase A2-2 In Complex With Delta- | 1e-04 | ||
| 2on5_A | 206 | Structure Of Nagst-2 Length = 206 | 2e-04 | ||
| 4acs_A | 222 | Crystal Structure Of Mutant Gst A2-2 With Enhanced | 2e-04 | ||
| 3m8n_A | 225 | Crystal Structure Of A Possible Gutathione S-Tranfe | 2e-04 | ||
| 3vwx_A | 222 | Structural Analysis Of An Epsilon-class Glutathione | 2e-04 | ||
| 2r3x_A | 222 | Crystal Structure Of An R15l Hgsta1-1 Mutant Comple | 2e-04 | ||
| 3l0h_B | 222 | Crystal Structure Analysis Of W21a Mutant Of Human | 2e-04 | ||
| 1guh_A | 221 | Structure Determination And Refinement Of Human Alp | 3e-04 | ||
| 3u6v_A | 222 | Crystal Structure Analysis Of L23a Mutant Of Human | 3e-04 | ||
| 1gse_A | 221 | Glutathione Transferase A1-1 Complexed With An Etha | 3e-04 | ||
| 1ydk_A | 222 | Crystal Structure Of The I219a Mutant Of Human Glut | 3e-04 | ||
| 1usb_A | 225 | Rational Design Of A Novel Enzyme - Efficient Thioe | 3e-04 | ||
| 4ikh_A | 244 | Crystal Structure Of A Glutathione Transferase Fami | 3e-04 | ||
| 3q74_A | 221 | Crystal Structure Analysis Of The L7a Mutant Of The | 3e-04 | ||
| 3zfb_A | 222 | Crystal Structure Of The I75a Mutant Of Human Class | 3e-04 | ||
| 1gul_A | 222 | Human Glutathione Transferase A4-4 Complex With Iod | 3e-04 | ||
| 3ein_A | 209 | Delta Class Gst Length = 209 | 3e-04 | ||
| 1pkw_A | 222 | Crystal Structure Of Human Glutathione Transferase | 4e-04 | ||
| 2r6k_A | 222 | Crystal Structure Of An I71v Hgsta1-1 Mutant In Com | 4e-04 | ||
| 1b4p_A | 217 | Crystal Structures Of Class Mu Chimeric Gst Isoenzy | 5e-04 | ||
| 1xwg_A | 221 | Human Gst A1-1 T68e Mutant Length = 221 | 5e-04 | ||
| 1pl2_A | 222 | Crystal Structure Of Human Glutathione Transferase | 6e-04 | ||
| 4hi7_A | 228 | Crystal Structure Of Glutathione Transferase Homolo | 8e-04 | ||
| 3zfl_A | 222 | Crystal Structure Of The V58a Mutant Of Human Class | 8e-04 | ||
| 1guk_A | 222 | Crystal Structure Of Murine Alpha-Class Gsta4-4 Len | 9e-04 |
| >pdb|1AW9|A Chain A, Structure Of Glutathione S-Transferase Iii In Apo Form Length = 216 | Back alignment and structure |
|
| >pdb|1BYE|A Chain A, Glutathione S-Transferase I From Mais In Complex With Atrazine Glutathione Conjugate Length = 213 | Back alignment and structure |
| >pdb|1AXD|A Chain A, Structure Of Glutathione S-transferase-i Bound With The Ligand Lactoylglutathione Length = 209 | Back alignment and structure |
| >pdb|1GNW|A Chain A, Structure Of Glutathione S-Transferase Length = 211 | Back alignment and structure |
| >pdb|3LSZ|A Chain A, Crystal Structure Of Glutathione S-Transferase From Rhodobacter Sphaeroides Length = 225 | Back alignment and structure |
| >pdb|4IEL|A Chain A, Crystal Structure Of A Glutathione S-Transferase Family Protein From Burkholderia Ambifaria, Target Efi-507141, With Bound Glutathione Length = 229 | Back alignment and structure |
| >pdb|3LQ7|A Chain A, Crystal Structure Of Glutathione S-Transferase From Agrobacterium Tumefaciens Str. C58 Length = 240 | Back alignment and structure |
| >pdb|2YCD|A Chain A, Structure Of A Novel Glutathione Transferase From Agrobacterium Tumefaciens Length = 230 | Back alignment and structure |
| >pdb|3AY8|A Chain A, Glutathione S-Transferase Unclassified 2 From Bombyx Mori Length = 216 | Back alignment and structure |
| >pdb|2C3N|A Chain A, Human Glutathione-S-Transferase T1-1, Apo Form Length = 247 | Back alignment and structure |
| >pdb|2C3Q|A Chain A, Human Glutathione-S-Transferase T1-1 W234r Mutant, Complex With S-Hexylglutathione Length = 247 | Back alignment and structure |
| >pdb|3M3M|A Chain A, Crystal Structure Of Glutathione S-Transferase From Pseudomonas Fluorescens [pf-5] Length = 210 | Back alignment and structure |
| >pdb|1JLV|A Chain A, Anopheles Dirus Species B Glutathione S-transferases 1-3 Length = 209 | Back alignment and structure |
| >pdb|4ECI|A Chain A, Crystal Structure Of Glutathione S-Transferase Prk13972 (Target Efi- 501853) From Pseudomonas Aeruginosa Pacs2 Complexed With Acetate Length = 244 | Back alignment and structure |
| >pdb|3VK9|A Chain A, Crystal Structure Of Delta-Class Glutathione Transferase From Silkmoth Length = 216 | Back alignment and structure |
| >pdb|3I69|A Chain A, Apo Glutathione Transferase A1-1 Gimf-Helix Mutant Length = 222 | Back alignment and structure |
| >pdb|1TDI|A Chain A, Crystal Structure Of Hgsta3-3 In Complex With Glutathione Length = 222 | Back alignment and structure |
| >pdb|3F6F|A Chain A, Crystal Structure Of Glutathione Transferase Dmgstd10 From Drosophila Melanogaster Length = 210 | Back alignment and structure |
| >pdb|1LJR|A Chain A, Glutathione Transferase (Hgst T2-2) From Human Length = 244 | Back alignment and structure |
| >pdb|3QAV|A Chain A, Crystal Structure Of A Glutathione S-transferase From Antarctic Clam Laternula Elliptica Length = 243 | Back alignment and structure |
| >pdb|1PN9|A Chain A, Crystal Structure Of An Insect Delta-class Glutathione S- Transferase From A Ddt-resistant Strain Of The Malaria Vector Anopheles Gambiae Length = 209 | Back alignment and structure |
| >pdb|4HZ2|A Chain A, Crystal Structure Of Glutathione S-Transferase Xaut_3756 (Target Efi- 507152) From Xanthobacter Autotrophicus Py2 Length = 230 | Back alignment and structure |
| >pdb|1V2A|A Chain A, Glutathione S-transferase 1-6 From Anopheles Dirus Species B Length = 210 | Back alignment and structure |
| >pdb|4HOJ|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Neisseria Gonorrhoeae, Target Efi-501841, With Bound Glutathione Length = 210 | Back alignment and structure |
| >pdb|2VCT|A Chain A, Glutathione Transferase A2-2 In Complex With Delta-4- Andostrene-3-17-Dione Length = 222 | Back alignment and structure |
| >pdb|2ON5|A Chain A, Structure Of Nagst-2 Length = 206 | Back alignment and structure |
| >pdb|4ACS|A Chain A, Crystal Structure Of Mutant Gst A2-2 With Enhanced Catalytic Efficiency With Azathioprine Length = 222 | Back alignment and structure |
| >pdb|3M8N|A Chain A, Crystal Structure Of A Possible Gutathione S-Tranferase From Rhodopseudomonas Palustris Length = 225 | Back alignment and structure |
| >pdb|3VWX|A Chain A, Structural Analysis Of An Epsilon-class Glutathione S-transferase From Housefly, Musca Domestica Length = 222 | Back alignment and structure |
| >pdb|2R3X|A Chain A, Crystal Structure Of An R15l Hgsta1-1 Mutant Complexed With S-Hexyl- Glutathione Length = 222 | Back alignment and structure |
| >pdb|3L0H|B Chain B, Crystal Structure Analysis Of W21a Mutant Of Human Gsta1-1 In Complex With S-Hexylglutathione Length = 222 | Back alignment and structure |
| >pdb|1GUH|A Chain A, Structure Determination And Refinement Of Human Alpha Class Glutathione Transferase A1-1, And A Comparison With The Mu And Pi Class Enzymes Length = 221 | Back alignment and structure |
| >pdb|3U6V|A Chain A, Crystal Structure Analysis Of L23a Mutant Of Human Gst A1-1 Length = 222 | Back alignment and structure |
| >pdb|1GSE|A Chain A, Glutathione Transferase A1-1 Complexed With An Ethacrynic Acid Glutathione Conjugate (Mutant R15k) Length = 221 | Back alignment and structure |
| >pdb|1YDK|A Chain A, Crystal Structure Of The I219a Mutant Of Human Glutathione Transferase A1-1 With S-Hexylglutathione Length = 222 | Back alignment and structure |
| >pdb|1USB|A Chain A, Rational Design Of A Novel Enzyme - Efficient Thioester Hydrolysis Enabled By The Incorporation Of A Single His Residue Into Human Glutathione Transferase A1-1 Length = 225 | Back alignment and structure |
| >pdb|4IKH|A Chain A, Crystal Structure Of A Glutathione Transferase Family Member From Psuedomonas Fluorescens Pf-5, Target Efi-900003, With Two Glutathione Bound Length = 244 | Back alignment and structure |
| >pdb|3Q74|A Chain A, Crystal Structure Analysis Of The L7a Mutant Of The Apo Form Of Human Alpha Class Glutathione Transferase Length = 221 | Back alignment and structure |
| >pdb|3ZFB|A Chain A, Crystal Structure Of The I75a Mutant Of Human Class Alpha Glutathione Transferase In The Apo Form Length = 222 | Back alignment and structure |
| >pdb|1GUL|A Chain A, Human Glutathione Transferase A4-4 Complex With Iodobenzyl Glutathione Length = 222 | Back alignment and structure |
| >pdb|3EIN|A Chain A, Delta Class Gst Length = 209 | Back alignment and structure |
| >pdb|1PKW|A Chain A, Crystal Structure Of Human Glutathione Transferase (Gst) A1-1 In Complex With Glutathione Length = 222 | Back alignment and structure |
| >pdb|2R6K|A Chain A, Crystal Structure Of An I71v Hgsta1-1 Mutant In Complex With S- Hexylglutathione Length = 222 | Back alignment and structure |
| >pdb|1B4P|A Chain A, Crystal Structures Of Class Mu Chimeric Gst Isoenzymes M1-2 And M2-1 Length = 217 | Back alignment and structure |
| >pdb|1XWG|A Chain A, Human Gst A1-1 T68e Mutant Length = 221 | Back alignment and structure |
| >pdb|1PL2|A Chain A, Crystal Structure Of Human Glutathione Transferase (Gst) A1- 1 T68e Mutant In Complex With Decarboxy-Glutathione Length = 222 | Back alignment and structure |
| >pdb|4HI7|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Drosophilia Mojavensis, Target Efi-501819, With Bound Glutathione Length = 228 | Back alignment and structure |
| >pdb|3ZFL|A Chain A, Crystal Structure Of The V58a Mutant Of Human Class Alpha Glutathione Transferase In The Apo Form Length = 222 | Back alignment and structure |
| >pdb|1GUK|A Chain A, Crystal Structure Of Murine Alpha-Class Gsta4-4 Length = 222 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 170 | |||
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 8e-66 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 3e-64 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 3e-64 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 1e-54 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 6e-51 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 4e-50 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 5e-48 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 1e-47 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 6e-42 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 3e-40 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 5e-40 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 2e-34 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 6e-34 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 3e-33 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 2e-32 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 4e-31 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 3e-30 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 9e-30 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 9e-30 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 3e-28 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 3e-27 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 5e-27 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 5e-27 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 3e-26 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 2e-25 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 5e-25 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 2e-24 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 3e-24 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 2e-23 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 9e-23 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 9e-23 | |
| 4g9h_A | 211 | Glutathione S-transferase; GST, enzyme function in | 1e-22 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 2e-22 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 3e-22 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 5e-21 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 8e-21 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 4e-20 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 5e-20 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 1e-19 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 1e-19 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 1e-19 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 1e-19 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 1e-19 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 5e-19 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 9e-19 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 1e-18 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 4e-18 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 1e-17 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 2e-17 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 3e-17 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 3e-17 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 3e-17 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 5e-17 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 8e-17 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 2e-16 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 3e-16 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 3e-16 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 4e-16 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 5e-16 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 9e-16 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 1e-15 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 1e-15 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 1e-15 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 1e-15 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 1e-15 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 2e-15 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 2e-15 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 3e-15 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 6e-15 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 8e-15 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 1e-14 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 1e-14 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 2e-14 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 2e-14 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 2e-14 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 3e-14 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 5e-14 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 6e-14 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 1e-13 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 2e-13 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 9e-13 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 2e-12 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 3e-12 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 5e-12 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 9e-10 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 7e-12 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 1e-11 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 2e-11 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 7e-11 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 9e-11 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 1e-10 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 2e-10 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 4e-07 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 6e-05 | |
| 2hra_A | 209 | Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l | 1e-04 |
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 | Back alignment and structure |
|---|
Score = 199 bits (508), Expect = 8e-66
Identities = 68/164 (41%), Positives = 100/164 (60%), Gaps = 4/164 (2%)
Query: 1 MQPFGELPVIQDGDFILYESRAIMRYYAEKYRSQGTELLG---KTIEERGLVEQWLEVEA 57
PFG++P +DGD L+ESRAI +Y A +Y +QGT LL K I + ++ ++VE
Sbjct: 48 RNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVED 107
Query: 58 HNYNPAIYELTIQLLFSSKFGRPVDEKLVKESDEKLGKTLDVYEERLSKSKYLAGDFFSL 117
H ++P +L + +F S +G DE +V E + KL K LDVYE RL + KYLAG+ F+L
Sbjct: 108 HQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTL 167
Query: 118 ADLSHIPFTHYLVGPMGRQHMIRDRKHVSAWWDDISNRPSWKKV 161
DL HIP YL+G + + +R V+ W +I+ RP+ +KV
Sbjct: 168 TDLHHIPAIQYLLG-TPTKKLFTERPRVNEWVAEITKRPASEKV 210
|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230 | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Length = 238 | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 | Back alignment and structure |
|---|
| >4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210 | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Length = 204 | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Length = 206 | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198 | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Length = 222 | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Length = 218 | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Length = 288 | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Length = 215 | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218 | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Length = 248 | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Length = 249 | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219 | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Length = 208 | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224 | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Length = 229 | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Length = 252 | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Length = 206 | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Length = 260 | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Length = 221 | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Length = 244 | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Length = 202 | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Length = 225 | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Length = 207 | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Length = 221 | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Length = 208 | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Length = 211 | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Length = 206 | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Length = 310 | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Length = 211 | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Length = 211 | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 | Back alignment and structure |
|---|
| >2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Length = 209 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 170 | |||
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 100.0 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 100.0 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 100.0 | |
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 100.0 | |
| 4gci_A | 211 | Glutathione S-transferase; GST, enzyme function in | 100.0 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 100.0 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 100.0 | |
| 4hz4_A | 217 | Glutathione-S-transferase; enzyme function initiat | 100.0 | |
| 4glt_A | 225 | Glutathione S-transferase-like protein; structural | 100.0 | |
| 4gf0_A | 215 | Glutathione S-transferase; GST, enzyme function in | 100.0 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 99.98 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 99.98 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 99.98 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 99.98 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 99.98 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 99.98 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 99.97 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 99.97 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 99.97 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 99.97 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 99.97 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 99.97 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 99.97 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 99.97 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 99.97 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 99.97 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 99.97 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 99.97 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 99.97 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 99.97 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 99.97 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 99.97 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 99.97 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 99.97 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 99.97 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 99.97 | |
| 4ikh_A | 244 | Glutathione S-transferase; enzyme function initiat | 99.97 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 99.97 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 99.97 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 99.97 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 99.97 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 99.97 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 99.97 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 99.97 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 99.97 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 99.97 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 99.97 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 99.97 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 99.97 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 99.97 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 99.97 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 99.97 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 99.97 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 99.97 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 99.97 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 99.97 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 99.97 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 99.97 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 99.97 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 99.97 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 99.97 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 99.97 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 99.97 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 99.97 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 99.97 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 99.97 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 99.97 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 99.97 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 99.97 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 99.97 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 99.96 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 99.96 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 99.96 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 99.96 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 99.96 | |
| 4g10_A | 265 | Glutathione S-transferase homolog; thioredoxin fol | 99.96 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 99.96 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 99.96 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 99.96 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 99.96 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 99.96 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 99.96 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 99.96 | |
| 4id0_A | 214 | Glutathione S-transferase-like protein YIBF; GST, | 99.96 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 99.96 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 99.96 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 99.96 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 99.96 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 99.96 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 99.96 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 99.96 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 99.95 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 99.95 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 99.95 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 99.94 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 99.94 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 99.94 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 99.94 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 99.93 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 99.93 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 99.93 | |
| 3m1g_A | 362 | Putative glutathione S-transferase; ECM4-like subf | 99.93 | |
| 3ppu_A | 352 | Glutathione-S-transferase; GST fold; HET: GSH; 2.3 | 99.93 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 99.93 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 99.92 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 99.91 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 99.91 | |
| 4g0i_A | 328 | Protein YQJG; glutathionyl-hydroquinone reductase, | 99.91 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.91 | |
| 4fqu_A | 313 | Putative glutathione transferase; glutathionyl-hyd | 99.91 | |
| 2hra_A | 209 | Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l | 99.87 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 99.86 | |
| 4f03_A | 253 | Glutathione transferase; GST fold; 1.80A {Phaneroc | 99.84 | |
| 2hsn_A | 160 | Methionyl-tRNA synthetase, cytoplasmic; protein co | 99.76 | |
| 2hqt_A | 124 | GU4 nucleic-binding protein 1; GST-fold, biosynthe | 99.41 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 95.86 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 95.69 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 93.13 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 91.78 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 87.38 |
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.6e-33 Score=193.35 Aligned_cols=160 Identities=42% Similarity=0.774 Sum_probs=134.7
Q ss_pred CCCCCCCCeeEeCCeEEeehHHHHHHHHHHhccCCCCCCCCC---HHHHHHHHHHHHHHHhhhchHHHHHHHHHHhhccc
Q 030871 1 MQPFGELPVIQDGDFILYESRAIMRYYAEKYRSQGTELLGKT---IEERGLVEQWLEVEAHNYNPAIYELTIQLLFSSKF 77 (170)
Q Consensus 1 ~~P~g~vP~l~~~~~~i~es~~I~~yl~~~~~~~~~~l~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 77 (170)
+||+|+||+|++||.+|+||.+|++||++++++.++.++|.+ +.++++++.|+.+.++.+...+....+.....+..
T Consensus 48 ~~P~g~vP~L~~~g~~l~eS~aI~~yL~~~~~~~~~~L~p~~~~~~~~~a~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~ 127 (211)
T 1gnw_A 48 RNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSKNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIY 127 (211)
T ss_dssp TCTTCCSCEEEETTEEEECHHHHHHHHHHHTTTSSSCCSCSSTTCHHHHHHHHHHHHHHHHTTHHHHHHHHHHHTHHHHT
T ss_pred hCCCCCCCEEEECCEEEeCHHHHHHHHHHHcCCCCCCCCCCCccCHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHhhhc
Confidence 589999999999999999999999999999974345689998 89999999999999888877666555544433333
Q ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHHhcCCCcccCCCccHhhhhhhhhHhhhcCCccccccccCCccHHHHHHHHhcChh
Q 030871 78 GRPVDEKLVKESDEKLGKTLDVYEERLSKSKYLAGDFFSLADLSHIPFTHYLVGPMGRQHMIRDRKHVSAWWDDISNRPS 157 (170)
Q Consensus 78 ~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~fl~G~~~t~aDi~l~~~l~~~~~~~~~~~~~~~~p~l~~w~~~~~~~p~ 157 (170)
+....+...+...+.+.+.|+.||++|++++|++|+++|+|||++++++.++......... ..+|+|.+|+++|.++|+
T Consensus 128 ~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~l~G~~~t~ADi~~~~~l~~~~~~~~~~~~-~~~p~l~~w~~~~~~~p~ 206 (211)
T 1gnw_A 128 GLTTDEAVVAEEEAKLAKVLDVYEARLKEFKYLAGETFTLTDLHHIPAIQYLLGTPTKKLF-TERPRVNEWVAEITKRPA 206 (211)
T ss_dssp TCCCCHHHHHHHHHHHHHHHHHHHHHHTTCSSSSSSSCCHHHHTTHHHHHHHTTSGGGHHH-HTSHHHHHHHHHHHSSHH
T ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHHhccCCCccCCCCCHHHHHHHHHHHHHHhcCcchhh-ccCchHHHHHHHHHcCch
Confidence 4445566777888899999999999999999999999999999999999988764322345 789999999999999999
Q ss_pred HHHH
Q 030871 158 WKKV 161 (170)
Q Consensus 158 ~~~~ 161 (170)
++++
T Consensus 207 ~~~~ 210 (211)
T 1gnw_A 207 SEKV 210 (211)
T ss_dssp HHTT
T ss_pred hhhh
Confidence 9875
|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
| >4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* | Back alignment and structure |
|---|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} | Back alignment and structure |
|---|
| >4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} | Back alignment and structure |
|---|
| >4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} | Back alignment and structure |
|---|
| >2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* | Back alignment and structure |
|---|
| >4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* | Back alignment and structure |
|---|
| >2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 170 | ||||
| d1gnwa1 | 126 | a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress | 6e-36 | |
| d1aw9a1 | 135 | a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays | 2e-29 | |
| d1axda1 | 129 | a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays | 9e-26 | |
| d1nhya1 | 144 | a.45.1.1 (A:76-219) GST-like domain of elongation | 2e-19 | |
| d1v2aa1 | 125 | a.45.1.1 (A:84-208) Class delta GST {Mosquito (Ano | 1e-17 | |
| d1pmta1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Proteus mirabi | 3e-16 | |
| d2cvda1 | 124 | a.45.1.1 (A:76-199) Class sigma GST {Human (Homo s | 4e-16 | |
| d1r5aa1 | 129 | a.45.1.1 (A:87-215) Class delta GST {Mosquito (Ano | 1e-15 | |
| d1ljra1 | 165 | a.45.1.1 (A:80-244) Class theta GST {Human (Homo s | 2e-15 | |
| d1k0da1 | 151 | a.45.1.1 (A:201-351) Yeast prion protein ure2p, ni | 2e-15 | |
| d1f2ea1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Sphingomonas p | 3e-15 | |
| d1b48a1 | 143 | a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus mu | 2e-14 | |
| d1tw9a1 | 129 | a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoid | 3e-14 | |
| d1gula1 | 140 | a.45.1.1 (A:81-220) Class alpha GST {Human (Homo s | 6e-14 | |
| d1jlva1 | 123 | a.45.1.1 (A:85-207) Class delta GST {Mosquito (Ano | 8e-14 | |
| d1jlwa1 | 127 | a.45.1.1 (A:91-217) Class delta GST {Mosquito (Ano | 9e-14 | |
| d1n2aa1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Escherichia co | 1e-13 | |
| d2gsqa1 | 127 | a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommast | 1e-13 | |
| d2gsta1 | 133 | a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norv | 7e-13 | |
| d1gsua1 | 133 | a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus | 1e-11 | |
| d2a2ra1 | 132 | a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapi | 2e-11 | |
| d1m0ua1 | 127 | a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (D | 7e-11 | |
| d1e6ba1 | 133 | a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cres | 1e-10 | |
| d3gtub1 | 140 | a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapi | 2e-10 | |
| d2c4ja1 | 133 | a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapi | 3e-10 | |
| d1tu7a1 | 131 | a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvu | 6e-10 | |
| d1k3ya1 | 142 | a.45.1.1 (A:81-222) Class alpha GST {Human (Homo s | 7e-10 | |
| d1okta1 | 126 | a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Pla | 1e-09 | |
| d1duga1 | 140 | a.45.1.1 (A:81-220) Class alpha GST {Schistosoma j | 6e-09 | |
| d2fhea1 | 136 | a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepa | 2e-08 | |
| d1k0ma1 | 149 | a.45.1.1 (A:92-240) Chloride intracellular channel | 4e-08 | |
| d1tw9a2 | 77 | c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides | 1e-07 | |
| d1oyja1 | 145 | a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sat | 2e-07 | |
| d2c4ja2 | 84 | c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapien | 3e-07 | |
| d2a2ra2 | 77 | c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapien | 3e-07 | |
| d1e6ba2 | 80 | c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress | 4e-07 | |
| d1gwca1 | 138 | a.45.1.1 (A:87-224) Class tau GST {Aegilops tausch | 4e-07 | |
| d1tu7a2 | 77 | c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulu | 5e-07 | |
| d1axda2 | 80 | c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), | 6e-07 | |
| d1gnwa2 | 84 | c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress ( | 7e-07 | |
| d1k3ya2 | 79 | c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sap | 1e-06 | |
| d1gula2 | 77 | c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sap | 2e-06 | |
| d1aw9a2 | 81 | c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), | 6e-06 | |
| d1fw1a1 | 125 | a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sa | 9e-06 | |
| d1m0ua2 | 76 | c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Dr | 1e-05 | |
| d1oe8a2 | 81 | c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Sc | 2e-05 | |
| d1eema1 | 139 | a.45.1.1 (A:103-241) Class omega GST {Human (Homo | 2e-05 | |
| d2cvda2 | 74 | c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sap | 3e-05 | |
| d1duga2 | 80 | c.47.1.5 (A:1-80) Class alpha GST {Schistosoma jap | 4e-05 | |
| d1b48a2 | 78 | c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musc | 5e-05 | |
| d2fnoa2 | 87 | c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752 | 6e-05 | |
| d1fw1a2 | 83 | c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi | 6e-05 | |
| d2gsqa2 | 75 | c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastre | 9e-05 | |
| d1ljra2 | 79 | c.47.1.5 (A:1-79) Class theta GST {Human (Homo sap | 1e-04 | |
| d1fhea2 | 80 | c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepati | 2e-04 | |
| d1jlva2 | 84 | c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph | 2e-04 | |
| d2hrkb1 | 118 | a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, | 2e-04 | |
| d1oe8a1 | 123 | a.45.1.1 (A:85-207) Class alpha GST {Blood fluke ( | 3e-04 | |
| d1okta2 | 85 | c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasm | 4e-04 | |
| d1oyja2 | 84 | c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ | 5e-04 | |
| d1r5aa2 | 85 | c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph | 7e-04 | |
| d1z9ha1 | 161 | a.45.1.1 (A:213-373) Microsomal prostaglandin E sy | 8e-04 | |
| d1gwca2 | 83 | c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii | 0.002 |
| >d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 126 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GST C-terminal domain-like superfamily: GST C-terminal domain-like family: Glutathione S-transferase (GST), C-terminal domain domain: Class phi GST species: Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 119 bits (299), Expect = 6e-36
Identities = 47/121 (38%), Positives = 72/121 (59%), Gaps = 1/121 (0%)
Query: 41 KTIEERGLVEQWLEVEAHNYNPAIYELTIQLLFSSKFGRPVDEKLVKESDEKLGKTLDVY 100
K I + ++ ++VE H ++P +L + +F S +G DE +V E + KL K LDVY
Sbjct: 6 KNISQYAIMAIGMQVEDHQFDPVASKLAFEQIFKSIYGLTTDEAVVAEEEAKLAKVLDVY 65
Query: 101 EERLSKSKYLAGDFFSLADLSHIPFTHYLVGPMGRQHMIRDRKHVSAWWDDISNRPSWKK 160
E RL + KYLAG+ F+L DL HIP YL+G + + +R V+ W +I+ RP+ +K
Sbjct: 66 EARLKEFKYLAGETFTLTDLHHIPAIQYLLG-TPTKKLFTERPRVNEWVAEITKRPASEK 124
Query: 161 V 161
V
Sbjct: 125 V 125
|
| >d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 135 | Back information, alignment and structure |
|---|
| >d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 129 | Back information, alignment and structure |
|---|
| >d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 144 | Back information, alignment and structure |
|---|
| >d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 125 | Back information, alignment and structure |
|---|
| >d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 121 | Back information, alignment and structure |
|---|
| >d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 129 | Back information, alignment and structure |
|---|
| >d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 151 | Back information, alignment and structure |
|---|
| >d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 121 | Back information, alignment and structure |
|---|
| >d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 143 | Back information, alignment and structure |
|---|
| >d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 129 | Back information, alignment and structure |
|---|
| >d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 123 | Back information, alignment and structure |
|---|
| >d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Length = 127 | Back information, alignment and structure |
|---|
| >d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 127 | Back information, alignment and structure |
|---|
| >d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 133 | Back information, alignment and structure |
|---|
| >d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Length = 133 | Back information, alignment and structure |
|---|
| >d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 132 | Back information, alignment and structure |
|---|
| >d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 127 | Back information, alignment and structure |
|---|
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 133 | Back information, alignment and structure |
|---|
| >d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 131 | Back information, alignment and structure |
|---|
| >d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 142 | Back information, alignment and structure |
|---|
| >d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 126 | Back information, alignment and structure |
|---|
| >d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 140 | Back information, alignment and structure |
|---|
| >d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 136 | Back information, alignment and structure |
|---|
| >d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 77 | Back information, alignment and structure |
|---|
| >d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 145 | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 | Back information, alignment and structure |
|---|
| >d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 138 | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 77 | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 | Back information, alignment and structure |
|---|
| >d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 | Back information, alignment and structure |
|---|
| >d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 81 | Back information, alignment and structure |
|---|
| >d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 80 | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 78 | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Length = 87 | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 75 | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 80 | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 | Back information, alignment and structure |
|---|
| >d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 118 | Back information, alignment and structure |
|---|
| >d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 123 | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 85 | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 | Back information, alignment and structure |
|---|
| >d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 161 | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 83 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 170 | |||
| d1axda1 | 129 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.93 | |
| d1aw9a1 | 135 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.93 | |
| d1gnwa1 | 126 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.91 | |
| d1n2aa1 | 121 | Class beta GST {Escherichia coli [TaxId: 562]} | 99.88 | |
| d1f2ea1 | 121 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.88 | |
| d1pmta1 | 121 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.86 | |
| d1nhya1 | 144 | GST-like domain of elongation factor 1-gamma {Bake | 99.86 | |
| d1ljra1 | 165 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 99.86 | |
| d3gtub1 | 140 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d1v2aa1 | 125 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.85 | |
| d2gsta1 | 133 | Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 | 99.85 | |
| d2gsqa1 | 127 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 99.85 | |
| d2c4ja1 | 133 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d2cvda1 | 124 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 99.85 | |
| d1gsua1 | 133 | Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 | 99.84 | |
| d1eema1 | 139 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 99.84 | |
| d1k0da1 | 151 | Yeast prion protein ure2p, nitrogen regulation fra | 99.83 | |
| d1jlwa1 | 127 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.83 | |
| d1m0ua1 | 127 | Class sigma GST {Fruit fly (Drosophila melanogaste | 99.83 | |
| d1b48a1 | 143 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 99.83 | |
| d1duga1 | 140 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 99.82 | |
| d1gwca1 | 138 | Class tau GST {Aegilops tauschii, also known as Tr | 99.82 | |
| d2a2ra1 | 132 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 99.82 | |
| d2fhea1 | 136 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 99.82 | |
| d1jlva1 | 123 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.82 | |
| d1tw9a1 | 129 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 99.81 | |
| d1fw1a1 | 125 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 99.81 | |
| d1k3ya1 | 142 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.81 | |
| d1gula1 | 140 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.8 | |
| d1e6ba1 | 133 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 99.79 | |
| d1r5aa1 | 129 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.78 | |
| d1okta1 | 126 | Pf GST {Malarial parasite (Plasmodium falciparum) | 99.77 | |
| d1tu7a1 | 131 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 99.73 | |
| d1oe8a1 | 123 | Class alpha GST {Blood fluke (Schistosoma haematob | 99.72 | |
| d1oyja1 | 145 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 99.71 | |
| d2hrkb1 | 118 | GU4 nucleic-binding protein 1, Arc1p {Baker's yeas | 99.47 | |
| d1k0ma1 | 149 | Chloride intracellular channel 1 (clic1) {Human (H | 99.46 | |
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.36 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.32 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.32 | |
| d1jlva2 | 84 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.31 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.22 | |
| d1axda2 | 80 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.2 | |
| d1tu7a2 | 77 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 99.18 | |
| d1k3ya2 | 79 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.17 | |
| d1f2ea2 | 80 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.17 | |
| d1z9ha1 | 161 | Microsomal prostaglandin E synthase-2 {Crab-eating | 99.17 | |
| d1fw1a2 | 83 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 99.16 | |
| d1gula2 | 77 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.14 | |
| d2c4ja2 | 84 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.14 | |
| d1b48a2 | 78 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 99.13 | |
| d1pmta2 | 80 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.13 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 99.12 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 99.12 | |
| d1tw9a2 | 77 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 99.11 | |
| d2a2ra2 | 77 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 99.11 | |
| d1m0ua2 | 76 | Class sigma GST {Fruit fly (Drosophila melanogaste | 99.11 | |
| d2gsqa2 | 75 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 99.1 | |
| d1n2aa2 | 80 | Class beta GST {Escherichia coli [TaxId: 562]} | 99.09 | |
| d1duga2 | 80 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 99.09 | |
| d1okta2 | 85 | Pf GST {Malarial parasite (Plasmodium falciparum) | 99.08 | |
| d2cvda2 | 74 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 99.06 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 99.01 | |
| d1fhea2 | 80 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 98.97 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 98.97 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 98.96 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 98.92 | |
| d1nhya2 | 75 | GST-like domain of elongation factor 1-gamma {Bake | 98.92 | |
| d2fnoa2 | 87 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 98.83 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 98.81 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 98.69 | |
| d1oe8a2 | 81 | Class alpha GST {Blood fluke (Schistosoma haematob | 98.45 | |
| d1g7oa1 | 140 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 98.3 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 98.24 | |
| d2fnoa1 | 149 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 97.62 |
| >d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GST C-terminal domain-like superfamily: GST C-terminal domain-like family: Glutathione S-transferase (GST), C-terminal domain domain: Class phi GST species: Maize (Zea mays), type I [TaxId: 4577]
Probab=99.93 E-value=2.1e-25 Score=141.18 Aligned_cols=126 Identities=44% Similarity=0.723 Sum_probs=114.5
Q ss_pred CCCCCHHHHHHHHHHHHHHHhhhchHHHHHHHHHHhhcccCCCCCHHHHHHHHHHHHHHHHHHHHHhcCCCcccCCCccH
Q 030871 38 LLGKTIEERGLVEQWLEVEAHNYNPAIYELTIQLLFSSKFGRPVDEKLVKESDEKLGKTLDVYEERLSKSKYLAGDFFSL 117 (170)
Q Consensus 38 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~fl~G~~~t~ 117 (170)
|.|.++.+++.++.|++|.++.+.+.+...+.+....+..+...+++..+...+.+.+.|+.+|+.|++++|++|+++|+
T Consensus 3 L~~~d~~erA~v~~Wl~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~l~Gd~~Tl 82 (129)
T d1axda1 3 LREGNLEEAAMVDVWIEVEANQYTAALNPILFQVLISPMLGGTTDQKVVDENLEKLKKVLEVYEARLTKCKYLAGDFLSL 82 (129)
T ss_dssp GTTTCHHHHHHHHHHHHHHHHTHHHHHHHHHHHHTHHHHHTCCCCHHHHHHHHHHHHHHHHHHHHHHHHCSSSSSSSCCH
T ss_pred CCCCCHHHHHHHHHHHHHHhhchhHHHHHHHHHHhhcccccCCCCHHHHHHHHHHHHHHHHHHHHHHccccccccCcccc
Confidence 66899999999999999999999999998888888777777777888999999999999999999999999999999999
Q ss_pred hhhhhhhhHhhhcCCccccccccCCccHHHHHHHHhcChhHHHHHHh
Q 030871 118 ADLSHIPFTHYLVGPMGRQHMIRDRKHVSAWWDDISNRPSWKKVLEL 164 (170)
Q Consensus 118 aDi~l~~~l~~~~~~~~~~~~~~~~p~l~~w~~~~~~~p~~~~~~~~ 164 (170)
|||++++.+.++......... .++|+|.+|+++|.+||++|++++.
T Consensus 83 ADi~~~~~~~~~~~~~~~~~~-~~~P~l~~w~~~~~~rPs~k~~~~~ 128 (129)
T d1axda1 83 ADLNHVSVTLCLFATPYASVL-DAYPHVKAWWSGLMERPSVQKVAAL 128 (129)
T ss_dssp HHHTTHHHHHHHTTSGGGGGG-GGCHHHHHHHHHHHHSHHHHHHHHH
T ss_pred ccHHHHHHHHHHHHcccccch-hhCHHHHHHHHHHHcCHHHHHHHhh
Confidence 999999999998876655556 7899999999999999999999863
|
| >d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|