Citrus Sinensis ID: 030916

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MVQCTSHMCPIRVHWHVKLNYKEYWRVKITITNFNYAMNYSLWNLVVQHPNFDNLTQLFSFYYKSLTPYEGLNDTAMLWGIKFYNDFLSEAGSNGNVQSELLFRKDASTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNASSRPVISLLRSAIIILASWVLLLAYV
cccccccccccEEEEEEEccccccEEEEEEEEEccccccccHHHHHHHcccccccEEEEEEccCCccccccccccEEEcccHHHHHHHHHcccccccccEEEEEEcccccEEccccccccEEEECcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHc
*VQCTSHMCPIRVHWHVKLNYKEYWRVKITITNFNYAMNYSLWNLVVQHPNFDNLTQLFSFYYKSLTPYEGLNDTAMLWGIKFYNDFLSEAGSNGNVQSELLFRKDASTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNASSRPVISLLRSAIIILASWVLLLAYV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVQCTSHMCPIRVHWHVKLNYKEYWRVKITITNFNYAMNYSLWNLVVQHPNFDNLTQLFSFYYKSLTPYEGLNDTAMLWGIKFYNDFLSEAGSNGNVQSELLFRKDASTFTFEKGWAFPRRIYFNGDNCVMPPPDAYPWLPNASSRPVISLLRSAIIILASWVLLLAYV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
COBRA-like protein 1 Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition. May act by recruiting cellulose synthesizing complexes to discrete positions on the cell surface.probableQ6Z4G8
Protein COBRA Involved in determining the orientation of cell expansion, probably by playing an important role in cellulose deposition. May act by recruiting cellulose synthesizing complexes to discrete positions on the cell surface.probableQ94KT8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted