Citrus Sinensis ID: 030930


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MVQTLAMPVAPALSVICNGHNNNLLTNASLSFPVSKQPQYPGLSIQCARVGGVEIPNNKRIEYSLQYIHGVGRTRARQILVDLKMENKITKDMSEEELITIRDEVSKYMIEGDLRRFNALAIRRLKEIQCYRGIRHIQGLPCRGQHTKNNCRTLKGKRVAIAGKKKAPR
cccccccccccHHHHHHccccccccccccEEccccccccccccccccEEEEcccccccccEEEEEEEEEcccHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccc
*******PVAPALSVICNGHNNNLLTNASLSFPVSKQPQYPGLSIQCARVGGVEIPNNKRIEYSLQYIHGVGRTRARQILVDLKMENKITKDMSEEELITIRDEVSKYMIEGDLRRFNALAIRRLKEIQCYRGIRHIQGLPCRGQHTKNNCRTLKGKRV**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVQTLAMPVAPALSVICNGHNNNLLTNASLSFPVSKQPQYPGLSIQCARVGGVEIPNNKRIEYSLQYIHGVGRTRARQILVDLKMENKITKDMSEEELITIRDEVSKYMIEGDLRRFNALAIRRLKEIQCYRGIRHIQGLPCRGQHTKNNCRTLKGKRVAIAGKKKAPR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
30S ribosomal protein S13, chloroplastic Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA.confidentP42732
30S ribosomal protein S13 Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.probableC5D3U2
30S ribosomal protein S13 Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.probableQ6KI31

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBN, chain M
Confidence level:very confident
Coverage over the Query: 48-104,115-156
View the alignment between query and template
View the model in PyMOL
Template: 2XZM, chain M
Confidence level:very confident
Coverage over the Query: 30-165
View the alignment between query and template
View the model in PyMOL