Citrus Sinensis ID: 030941

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17

MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSAEGADEDEGVDDQAVKVVDIVDTFRLQEQPAFDKKQFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYIADALKEVKC

cEEEEcccccccccccccccEECcccEEEEEEEEEEEEcccCEEccccccccccccccccccccEEEEEEEEcccCECcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccEEEccccccccEEEEEEcccccccCEEEEEcccccEEcc

MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGA***************QAVKVVDIVDTFRLQEQPAFDKKQFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYIADALKEVKC

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSAEGADEDEGVDDQAVKVVDIVDTFRLQEQPAFDKKQFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYIADALKEVKC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Translationally-controlled tumor protein homolog	Involved in calcium binding and microtubule stabilization.	confident	P35681
Translationally-controlled tumor protein homolog	Involved in calcium binding and microtubule stabilization.	confident	P31265
Translationally-controlled tumor protein homolog	Involved in calcium binding and microtubule stabilization.	confident	Q9ZSW9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KWB, chain A
Confidence level:very confident
Coverage over the Query: 1-168
View the alignment between query and template
View the model in PyMOL