Citrus Sinensis ID: 030948

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17

MFLRVIGRPLMAKVKQTTGITGLDVVPNAREVLINLYNKTLKEIQAVPPDEGYRKAVESFTRQRLKVCQEEEDWEQIEKRLGCGQVEELIEEAQDELTLIGKMIEWDPWGVPDDYECEVIENDAPVPKHVPLHRPGPLPEEFHKTLEAVTKKDPTAVTSSESQSRLKE

cHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccHHHccc

*FLRVIGRPLMAKVKQTTGITGLDVVPNAREVLINLYNKTLKEIQAVPPDEGYRKAVESFTRQRLKVCQEEEDWEQIEKRLGCGQVEELIEEAQDELTLIGKMIEWDPWGVPDDYECEVIEND*****************EFHKTLE*********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MFLRVIGRPLMAKVKQTTGITGLDVVPNAREVLINLYNKTLKEIQAVPPDEGYRKAVESFTRQRLKVCQEEEDWEQIEKRLGCGQVEELIEEAQDELTLIGKMIEWDPWGVPDDYECEVIENDAPVPKHVPLHRPGPLPEEFHKTLEAVTKKDPTAVTSSESQSRLKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.	confident	Q9FLX7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W1N, chain A
Confidence level:probable
Coverage over the Query: 83-109
View the alignment between query and template
View the model in PyMOL