Citrus Sinensis ID: 030949

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17

MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGKDMTQVNMFGFSILFCNLFYLNMFMRISGDLFFSFPFSYRQDSTFEFERKRNRPERYDRNLAENTLKAIKKIDKIRVAREERHHKLRFVIFLYYILTCILRFSVPTVI

ccEEEEEccccccccccCEEEEEEcccEEEEEcHHHHHHHHccccccccHHHHHHHHHccccccEEccccEEHHHHHHHHHHHHHHccccccccccccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc

MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGKDMTQVNMFGFSILFCNLFYLNMFMRISGDLFFSFPFSYRQDSTFE*****NRPERYDRNLAENTLKAIKKIDKIRVAREERHHKLRFVIFLYYILTCILRFSVPTVI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGKDMTQVNMFGFSILFCNLFYLNMFMRISGDLFFSFPFSYRQDSTFEFERKRNRPERYDRNLAENTLKAIKKIDKIRVAREERHHKLRFVIFLYYILTCILRFSVPTVI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable ribosome biogenesis protein RLP24	Involved in the biogenesis of the 60S ribosomal subunit. Ensures the docking of NOG1 to pre-60S particles.	probable	O22165

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain u
Confidence level:very confident
Coverage over the Query: 4-56
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
3izc, chain Z		very confident	Alignment \| Template Structure