Citrus Sinensis ID: 030949
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 168 | ||||||
| 147803507 | 1073 | hypothetical protein VITISV_033681 [Viti | 0.660 | 0.103 | 0.721 | 2e-57 | |
| 225436335 | 168 | PREDICTED: probable ribosome biogenesis | 0.666 | 0.666 | 0.716 | 7e-53 | |
| 225440980 | 168 | PREDICTED: probable ribosome biogenesis | 0.666 | 0.666 | 0.722 | 1e-52 | |
| 356565687 | 168 | PREDICTED: probable ribosome biogenesis | 0.666 | 0.666 | 0.716 | 4e-52 | |
| 356539307 | 169 | PREDICTED: probable ribosome biogenesis | 0.666 | 0.662 | 0.709 | 1e-51 | |
| 356542711 | 168 | PREDICTED: probable ribosome biogenesis | 0.666 | 0.666 | 0.702 | 1e-51 | |
| 351734528 | 168 | uncharacterized protein LOC100306000 [Gl | 0.666 | 0.666 | 0.702 | 2e-51 | |
| 356534538 | 174 | PREDICTED: LOW QUALITY PROTEIN: probable | 0.648 | 0.626 | 0.710 | 4e-51 | |
| 224103027 | 168 | predicted protein [Populus trichocarpa] | 0.678 | 0.678 | 0.68 | 2e-49 | |
| 224132060 | 168 | predicted protein [Populus trichocarpa] | 0.678 | 0.678 | 0.673 | 5e-49 |
| >gi|147803507|emb|CAN68722.1| hypothetical protein VITISV_033681 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 226 bits (576), Expect = 2e-57, Method: Composition-based stats.
Identities = 106/147 (72%), Positives = 108/147 (73%), Gaps = 36/147 (24%)
Query: 1 MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 60
MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG
Sbjct: 57 MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 116
Query: 61 KDMTQVNMFGFSILFCNLFYLNMFMRISGDLFFSFPFSYRQDSTFEFERKRNRPERYDRN 120
KDMT QDSTFEFERKRNRPERYDRN
Sbjct: 117 KDMT------------------------------------QDSTFEFERKRNRPERYDRN 140
Query: 121 LAENTLKAIKKIDKIRVAREERHHKLR 147
+AENTLKAIKKIDK+RV RE RHH LR
Sbjct: 141 VAENTLKAIKKIDKVRVDREARHHALR 167
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225436335|ref|XP_002268489.1| PREDICTED: probable ribosome biogenesis protein RLP24 [Vitis vinifera] gi|297734845|emb|CBI17079.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225440980|ref|XP_002283418.1| PREDICTED: probable ribosome biogenesis protein RLP24 [Vitis vinifera] gi|297740070|emb|CBI30252.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356565687|ref|XP_003551069.1| PREDICTED: probable ribosome biogenesis protein RLP24-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356539307|ref|XP_003538140.1| PREDICTED: probable ribosome biogenesis protein RLP24-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356542711|ref|XP_003539809.1| PREDICTED: probable ribosome biogenesis protein RLP24-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|351734528|ref|NP_001236121.1| uncharacterized protein LOC100306000 [Glycine max] gi|255627233|gb|ACU13961.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356534538|ref|XP_003535810.1| PREDICTED: LOW QUALITY PROTEIN: probable ribosome biogenesis protein RLP24-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224103027|ref|XP_002312895.1| predicted protein [Populus trichocarpa] gi|118482826|gb|ABK93329.1| unknown [Populus trichocarpa] gi|222849303|gb|EEE86850.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224132060|ref|XP_002328175.1| predicted protein [Populus trichocarpa] gi|222837690|gb|EEE76055.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 168 | ||||||
| TAIR|locus:2054982 | 159 | AT2G44860 [Arabidopsis thalian | 0.422 | 0.446 | 0.873 | 1.6e-49 | |
| DICTYBASE|DDB_G0272789 | 164 | rlp24 "ribosomal protein L24-l | 0.380 | 0.390 | 0.765 | 5.7e-38 | |
| UNIPROTKB|E1BV86 | 163 | LOC768911 "Uncharacterized pro | 0.422 | 0.435 | 0.690 | 5.7e-36 | |
| UNIPROTKB|Q3SZ12 | 163 | RSL24D1 "Probable ribosome bio | 0.422 | 0.435 | 0.690 | 1.5e-35 | |
| UNIPROTKB|E2QUH4 | 163 | RSL24D1 "Uncharacterized prote | 0.422 | 0.435 | 0.690 | 1.5e-35 | |
| UNIPROTKB|F1RZD9 | 163 | RSL24D1 "Uncharacterized prote | 0.422 | 0.435 | 0.690 | 1.5e-35 | |
| MGI|MGI:2681840 | 163 | Rsl24d1 "ribosomal L24 domain | 0.422 | 0.435 | 0.690 | 1.5e-35 | |
| RGD|1309784 | 163 | Rsl24d1 "ribosomal L24 domain | 0.422 | 0.435 | 0.690 | 1.5e-35 | |
| UNIPROTKB|Q9UHA3 | 163 | RSL24D1 "Probable ribosome bio | 0.422 | 0.435 | 0.690 | 1.9e-35 | |
| ZFIN|ZDB-GENE-040426-1925 | 161 | rsl24d1 "ribosomal L24 domain | 0.422 | 0.440 | 0.690 | 1.7e-34 |
| TAIR|locus:2054982 AT2G44860 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 357 (130.7 bits), Expect = 1.6e-49, Sum P(2) = 1.6e-49
Identities = 62/71 (87%), Positives = 65/71 (91%)
Query: 1 MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 60
MRLEKCWFCSST+YPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKA+R HG
Sbjct: 1 MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAFRAAHG 60
Query: 61 KDMTQVNMFGF 71
KDMT+ F F
Sbjct: 61 KDMTKDTTFEF 71
|
|
| DICTYBASE|DDB_G0272789 rlp24 "ribosomal protein L24-like protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BV86 LOC768911 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3SZ12 RSL24D1 "Probable ribosome biogenesis protein RLP24" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QUH4 RSL24D1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RZD9 RSL24D1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2681840 Rsl24d1 "ribosomal L24 domain containing 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1309784 Rsl24d1 "ribosomal L24 domain containing 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UHA3 RSL24D1 "Probable ribosome biogenesis protein RLP24" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1925 rsl24d1 "ribosomal L24 domain containing 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00021667001 | SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (168 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00025456001 | • | • | • | • | 0.981 | ||||||
| GSVIVG00038765001 | • | • | • | • | 0.968 | ||||||
| GSVIVG00018373001 | • | • | • | • | 0.962 | ||||||
| GSVIVG00016877001 | • | • | • | • | 0.950 | ||||||
| GSVIVG00002292001 | • | • | • | 0.949 | |||||||
| Ndpk | • | • | • | 0.919 | |||||||
| GSVIVG00019030001 | • | • | • | 0.912 | |||||||
| GSVIVG00031140001 | • | • | 0.901 | ||||||||
| GSVIVG00021307001 | • | • | 0.889 | ||||||||
| GSVIVG00017864001 | • | • | • | 0.870 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 168 | |||
| COG2075 | 66 | COG2075, RPL24A, Ribosomal protein L24E [Translati | 1e-29 | |
| pfam01246 | 71 | pfam01246, Ribosomal_L24e, Ribosomal protein L24e | 2e-29 | |
| cd00472 | 54 | cd00472, Ribosomal_L24e_L24, Ribosomal protein L24 | 8e-29 | |
| PRK00807 | 52 | PRK00807, PRK00807, 50S ribosomal protein L24e; Va | 2e-18 | |
| PRK14891 | 131 | PRK14891, PRK14891, 50S ribosomal protein L24e/unk | 7e-17 | |
| PTZ00033 | 125 | PTZ00033, PTZ00033, 60S ribosomal protein L24; Pro | 7e-10 | |
| smart00746 | 39 | smart00746, TRASH, metallochaperone-like domain | 6e-08 |
| >gnl|CDD|224986 COG2075, RPL24A, Ribosomal protein L24E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Score = 102 bits (257), Expect = 1e-29
Identities = 35/66 (53%), Positives = 47/66 (71%)
Query: 1 MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 60
M++ C FC + PG GI +VRND K+ RFC SKC K FK+ RNPRK+KWTK YR++H
Sbjct: 1 MKVRVCSFCGKKIEPGTGIMYVRNDGKVLRFCSSKCEKLFKLGRNPRKLKWTKKYRKMHK 60
Query: 61 KDMTQV 66
K++ +
Sbjct: 61 KEIKEE 66
|
Length = 66 |
| >gnl|CDD|110260 pfam01246, Ribosomal_L24e, Ribosomal protein L24e | Back alignment and domain information |
|---|
| >gnl|CDD|100103 cd00472, Ribosomal_L24e_L24, Ribosomal protein L24e/L24 is a ribosomal protein found in eukaryotes (L24) and in archaea (L24e, distinct from archaeal L24) | Back alignment and domain information |
|---|
| >gnl|CDD|179131 PRK00807, PRK00807, 50S ribosomal protein L24e; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|184885 PRK14891, PRK14891, 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140068 PTZ00033, PTZ00033, 60S ribosomal protein L24; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214799 smart00746, TRASH, metallochaperone-like domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 168 | |||
| PTZ00033 | 125 | 60S ribosomal protein L24; Provisional | 100.0 | |
| KOG1723 | 162 | consensus 60s ribosomal protein L30 isolog [Transl | 100.0 | |
| KOG1722 | 155 | consensus 60s ribosomal protein L24 [Translation, | 100.0 | |
| PF01246 | 71 | Ribosomal_L24e: Ribosomal protein L24e; InterPro: | 100.0 | |
| PRK14891 | 131 | 50S ribosomal protein L24e/unknown domain fusion p | 100.0 | |
| COG2075 | 66 | RPL24A Ribosomal protein L24E [Translation, riboso | 100.0 | |
| cd00472 | 54 | Ribosomal_L24e_L24 Ribosomal protein L24e/L24 is a | 99.97 | |
| PRK00807 | 52 | 50S ribosomal protein L24e; Validated | 99.95 | |
| smart00746 | 39 | TRASH metallochaperone-like domain. | 98.43 | |
| PF08394 | 37 | Arc_trans_TRASH: Archaeal TRASH domain; InterPro: | 96.63 | |
| PF04945 | 47 | YHS: YHS domain; InterPro: IPR007029 This short pr | 96.46 | |
| PF06467 | 43 | zf-FCS: MYM-type Zinc finger with FCS sequence mot | 95.39 | |
| PF09889 | 59 | DUF2116: Uncharacterized protein containing a Zn-r | 94.75 | |
| PF05573 | 149 | NosL: NosL; InterPro: IPR008719 NosL is one of the | 91.24 | |
| COG3350 | 53 | Uncharacterized conserved protein [Function unknow | 89.9 | |
| PF09943 | 101 | DUF2175: Uncharacterized protein conserved in arch | 87.1 |
| >PTZ00033 60S ribosomal protein L24; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.6e-42 Score=269.05 Aligned_cols=93 Identities=32% Similarity=0.621 Sum_probs=89.0
Q ss_pred CceeeeecCCCCccCCccceEEe----eCCceEEEechhhhhhhhcccCCccchhhHHHHHHhCCcceeeecccchhhhh
Q 030949 1 MRLEKCWFCSSTVYPGHGIQFVR----NDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGKDMTQVNMFGFSILFC 76 (168)
Q Consensus 1 Mkie~CsFcG~kIYPGhG~~fVR----nDGkvF~FcsSKC~k~fk~KRNPRKlkWT~~yRr~~KK~~~~~~~~~~~~~~~ 76 (168)
|+++.|+|||++||||||++||+ +||++|+||||||+++|++|+|||+|+||++||++|||+++
T Consensus 1 Mk~~~C~Fsg~~IyPG~G~~~Vr~~~~~Dgkv~~F~~sKc~~~~~~krnPRkl~WT~~yRr~~kK~~~------------ 68 (125)
T PTZ00033 1 MRTIACEFSHFAVHPGHGRRYVPFAFLSTKPVLTFLRPKCFALYMRKKNPRFLPWTRTYRRINRKTTT------------ 68 (125)
T ss_pred CceeEecCcCCcccCCCCcEeeecccCCCCCEEEEecHHHHHHHHCcCCCccchHHHHHHHHhCCcch------------
Confidence 89999999999999999999999 99999999999999999999999999999999999999977
Q ss_pred hHhhhhhHHhhhcCccccCCCcccCCchHHHHHhhCCCccccHHHHHHHHHHHHhH
Q 030949 77 NLFYLNMFMRISGDLFFSFPFSYRQDSTFEFERKRNRPERYDRNLAENTLKAIKKI 132 (168)
Q Consensus 77 ~~~~~~~~~~~~~~~~~~~~~~~~~d~t~e~ekrrn~~~ky~R~l~~~tl~aik~v 132 (168)
+| + +++|+|+|++|||+|||+|||+|++.
T Consensus 69 ------------------------e~-~--~kkR~~rtvK~qRaivg~sLe~I~~k 97 (125)
T PTZ00033 69 ------------------------DR-V--QRRRAARTVKVQRAIVGADLSYIQEV 97 (125)
T ss_pred ------------------------hH-H--HHHHhcCCccchHHHHHHHHHHHHHH
Confidence 44 4 49999999999999999999999986
|
|
| >KOG1723 consensus 60s ribosomal protein L30 isolog [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1722 consensus 60s ribosomal protein L24 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01246 Ribosomal_L24e: Ribosomal protein L24e; InterPro: IPR000988 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PRK14891 50S ribosomal protein L24e/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >COG2075 RPL24A Ribosomal protein L24E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd00472 Ribosomal_L24e_L24 Ribosomal protein L24e/L24 is a ribosomal protein found in eukaryotes (L24) and in archaea (L24e, distinct from archaeal L24) | Back alignment and domain information |
|---|
| >PRK00807 50S ribosomal protein L24e; Validated | Back alignment and domain information |
|---|
| >smart00746 TRASH metallochaperone-like domain | Back alignment and domain information |
|---|
| >PF08394 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators | Back alignment and domain information |
|---|
| >PF04945 YHS: YHS domain; InterPro: IPR007029 This short presumed domain is about 50 amino acid residues long | Back alignment and domain information |
|---|
| >PF06467 zf-FCS: MYM-type Zinc finger with FCS sequence motif; InterPro: IPR010507 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF09889 DUF2116: Uncharacterized protein containing a Zn-ribbon (DUF2116); InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown | Back alignment and domain information |
|---|
| >PF05573 NosL: NosL; InterPro: IPR008719 NosL is one of the accessory proteins of the nos (nitrous oxide reductase) gene cluster | Back alignment and domain information |
|---|
| >COG3350 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09943 DUF2175: Uncharacterized protein conserved in archaea (DUF2175); InterPro: IPR018686 This family of various hypothetical archaeal proteins has no known function | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 168 | ||||
| 2zkr_u | 157 | Structure Of A Mammalian Ribosomal 60s Subunit With | 5e-13 | ||
| 3izs_Z | 155 | Localization Of The Large Subunit Ribosomal Protein | 1e-11 | ||
| 3izr_Z | 162 | Localization Of The Large Subunit Ribosomal Protein | 2e-10 | ||
| 1s1i_S | 56 | Structure Of The Ribosomal 80s-Eef2-Sordarin Comple | 7e-10 | ||
| 3j21_V | 66 | Promiscuous Behavior Of Proteins In Archaeal Riboso | 1e-09 | ||
| 3jyw_S | 45 | Structure Of The 60s Proteins For Eukaryotic Riboso | 1e-08 | ||
| 2qa4_U | 67 | A More Complete Structure Of The The L7L12 STALK OF | 5e-08 | ||
| 1ffk_R | 66 | Crystal Structure Of The Large Ribosomal Subunit Fr | 5e-08 | ||
| 3zf7_Y | 125 | High-resolution Cryo-electron Microscopy Structure | 3e-07 | ||
| 3g4s_U | 53 | Co-Crystal Structure Of Tiamulin Bound To The Large | 9e-07 |
| >pdb|2ZKR|UU Chain u, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 157 | Back alignment and structure |
|
| >pdb|3IZS|Z Chain Z, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 155 | Back alignment and structure |
| >pdb|3IZR|Z Chain Z, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 162 | Back alignment and structure |
| >pdb|1S1I|S Chain S, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h. Length = 56 | Back alignment and structure |
| >pdb|3J21|V Chain V, Promiscuous Behavior Of Proteins In Archaeal Ribosomes Revealed By Cryo-em: Implications For Evolution Of Eukaryotic Ribosomes (50s Ribosomal Proteins) Length = 66 | Back alignment and structure |
| >pdb|3JYW|S Chain S, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 45 | Back alignment and structure |
| >pdb|2QA4|U Chain U, A More Complete Structure Of The The L7L12 STALK OF THE Haloarcula Marismortui 50s Large Ribosomal Subunit Length = 67 | Back alignment and structure |
| >pdb|1FFK|R Chain R, Crystal Structure Of The Large Ribosomal Subunit From Haloarcula Marismortui At 2.4 Angstrom Resolution Length = 66 | Back alignment and structure |
| >pdb|3ZF7|Y Chain Y, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 125 | Back alignment and structure |
| >pdb|3G4S|U Chain U, Co-Crystal Structure Of Tiamulin Bound To The Large Ribosomal Subunit Length = 53 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 168 | |||
| 3iz5_Z | 162 | 60S ribosomal protein L24 (L24E); eukaryotic ribos | 5e-38 | |
| 2zkr_u | 157 | 60S ribosomal protein L24; protein-RNA complex, 60 | 7e-37 | |
| 3izc_Z | 155 | 60S ribosomal protein RPL24 (L24E); eukaryotic rib | 9e-36 | |
| 4a17_T | 158 | RPL24, 60S ribosomal protein L21; eukaryotic ribos | 9e-34 | |
| 1vq8_U | 66 | 50S ribosomal protein L24E; ribosome 50S, protein- | 2e-31 | |
| 3jyw_S | 45 | 60S ribosomal protein L24(A); eukaryotic ribosome, | 7e-22 |
| >2zkr_u 60S ribosomal protein L24; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 157 | Back alignment and structure |
|---|
| >4a17_T RPL24, 60S ribosomal protein L21; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_T 4a1c_T 4a1e_T Length = 158 | Back alignment and structure |
|---|
| >1vq8_U 50S ribosomal protein L24E; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.39.1.6 PDB: 1giy_R 1jj2_T 1k73_V* 1k8a_V* 1k9m_V* 1kc8_V* 1kd1_V* 1kqs_T* 1m1k_V* 1m90_V* 1ml5_r* 1n8r_V* 1nji_V* 1q7y_V* 1q81_V* 1q82_V* 1q86_V* 1qvf_T 1qvg_T 1s72_U* ... Length = 66 | Back alignment and structure |
|---|
| >3jyw_S 60S ribosomal protein L24(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Length = 45 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 168 | |||
| 3izc_Z | 155 | 60S ribosomal protein RPL24 (L24E); eukaryotic rib | 100.0 | |
| 4a17_T | 158 | RPL24, 60S ribosomal protein L21; eukaryotic ribos | 100.0 | |
| 2zkr_u | 157 | 60S ribosomal protein L24; protein-RNA complex, 60 | 100.0 | |
| 3iz5_Z | 162 | 60S ribosomal protein L24 (L24E); eukaryotic ribos | 100.0 | |
| 1vq8_U | 66 | 50S ribosomal protein L24E; ribosome 50S, protein- | 100.0 | |
| 3j21_V | 66 | 50S ribosomal protein L24E; archaea, archaeal, KIN | 100.0 | |
| 3jyw_S | 45 | 60S ribosomal protein L24(A); eukaryotic ribosome, | 99.95 | |
| 2hpu_A | 175 | NOSL protein; alpha beta topology, metal transport | 91.41 | |
| 2l8e_A | 49 | Polyhomeotic-like protein 1; DNA binding protein; | 85.96 | |
| 1mty_D | 512 | Methane monooxygenase hydroxylase; dinuclear iron | 84.46 |
| >4a17_T RPL24, 60S ribosomal protein L21; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_T 4a1c_T 4a1e_T | Back alignment and structure |
|---|
| >2zkr_u 60S ribosomal protein L24; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} | Back alignment and structure |
|---|
| >1vq8_U 50S ribosomal protein L24E; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.39.1.6 PDB: 1giy_R 1jj2_T 1k73_V* 1k8a_V* 1k9m_V* 1kc8_V* 1kd1_V* 1kqs_T* 1m1k_V* 1m90_V* 1ml5_r* 1n8r_V* 1nji_V* 1q7y_V* 1q81_V* 1q82_V* 1q86_V* 1qvf_T 1qvg_T 1s72_U* ... | Back alignment and structure |
|---|
| >3j21_V 50S ribosomal protein L24E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3jyw_S 60S ribosomal protein L24(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} | Back alignment and structure |
|---|
| >2hpu_A NOSL protein; alpha beta topology, metal transport; NMR {Achromobacter cycloclastes} SCOP: d.357.1.1 PDB: 2hq3_A | Back alignment and structure |
|---|
| >2l8e_A Polyhomeotic-like protein 1; DNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mty_D Methane monooxygenase hydroxylase; dinuclear iron center monooxygenase; 1.70A {Methylococcus capsulatus str} SCOP: a.25.1.2 PDB: 1mmo_D 1xvb_A 1fyz_A 1fz0_A 1fz2_A 1fz3_A 1fz4_A 1fz5_A 1fz6_A 1fz7_A 1fz8_A 1fz9_A 1fzh_A 1fzi_A 1xmf_A 1xmg_A 1xmh_A 1xu3_A 1xu5_A 1fz1_A ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 168 | ||||
| d1vqou1 | 53 | g.39.1.6 (U:4-56) Ribosomal protein L24e {Archaeon | 1e-26 |
| >d1vqou1 g.39.1.6 (U:4-56) Ribosomal protein L24e {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 53 | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: Ribosomal protein L24e domain: Ribosomal protein L24e species: Archaeon Haloarcula marismortui [TaxId: 2238]
Score = 93.2 bits (232), Expect = 1e-26
Identities = 19/52 (36%), Positives = 26/52 (50%)
Query: 5 KCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYR 56
+C +C + + PG G FV D FC SKC N + R R ++WT R
Sbjct: 2 ECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR 53
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 168 | |||
| d1vqou1 | 53 | Ribosomal protein L24e {Archaeon Haloarcula marism | 99.97 |
| >d1vqou1 g.39.1.6 (U:4-56) Ribosomal protein L24e {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: Ribosomal protein L24e domain: Ribosomal protein L24e species: Archaeon Haloarcula marismortui [TaxId: 2238]
Probab=99.97 E-value=8.2e-33 Score=186.73 Aligned_cols=53 Identities=36% Similarity=0.848 Sum_probs=51.5
Q ss_pred eeeecCCCCccCCccceEEeeCCceEEEechhhhhhhhcccCCccchhhHHHH
Q 030949 4 EKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYR 56 (168)
Q Consensus 4 e~CsFcG~kIYPGhG~~fVRnDGkvF~FcsSKC~k~fk~KRNPRKlkWT~~yR 56 (168)
.+|+|||++||||||+||||+||++|+||||||+++|++|+|||||+||++||
T Consensus 1 r~CsF~g~~I~PG~G~~~Vr~Dg~v~~F~ssKc~~~~~~krnPrk~~WT~~yR 53 (53)
T d1vqou1 1 RECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR 53 (53)
T ss_dssp CBCTTTCCBCCTTCCEEEECTTSCEEEESCHHHHHHHHTTCCGGGCTTSTTTC
T ss_pred CcccccCCeecCCCCEEEEecCCCEEEEeCHHHHHHHHcCCCcccceeeeccC
Confidence 37999999999999999999999999999999999999999999999999986
|