Citrus Sinensis ID: 030950


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MATVTSAAVTVPTFTGLKAGATPARVVGSTMKASASAVPKLSIKATLKDVGVAVAATAASAMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN
cccEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccCEEccEEEEccccEEEEEEcccccEEEEEcccccccccccccccccccccccccccEEEEEccccEEEEEEcccccccccEEEEEEc
********VTVPTFTGLKAG********************LSIKATLKDVGVAVAATAASAMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKI*****DLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATVTSAAVTVPTFTGLKAGATPARVVGSTMKASASAVPKLSIKATLKDVGVAVAATAASAMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Plastocyanin A, chloroplastic Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I.probableP00299
Plastocyanin, chloroplastic Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I.probableP00289
Plastocyanin minor isoform, chloroplastic Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I. Seems to be a minor plastocyanin in Arabidopsis.probableP11490

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PLC, chain A
Confidence level:very confident
Coverage over the Query: 70-168
View the alignment between query and template
View the model in PyMOL
Template: 2PQ4, chain B
Confidence level:probable
Coverage over the Query: 40-48
View the alignment between query and template
View the model in PyMOL