Citrus Sinensis ID: 030950

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MATVTSAAVTVPTFTGLKAGATPARVVGSTMKASASAVPKLSIKATLKDVGVAVAATAASAMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN
cccEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccEEEccEEEEccccEEEEEEcccccEEEEEcccccccccccccccccccccccccccEEEEEccccEEEEEEcccccccccEEEEEEc
cccEEHHHEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEcEEEEccccccccEEccEEEEccccEEEEEEcccccEccEEcHHHccccccHHHHcccccccEcccccEEEEEccccEEEEEEcHHHcccccEEEEEEc
MATVTSAAVtvptftglkagatparvvgstMKASASAVPKLSIKATLKDVGVAVAATAASAMLASNAMAIEVLLggddgslafvpssfsvssgekivfknnagfphnvvfdedeipsgvdvskismstedllngpgetyavtltekgtysfycsphqgagmvgqvtvn
matvtsaavtvptftglkagatparvVGSTMKASASAVPKLSIKATLKDVGVAVAATAASAMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMstedllngpGETYAVTLTEKGTYSFYCSphqgagmvgqvtvn
MatvtsaavtvptftGLKAGATPARVVGSTMKASASAVPKLSIKATLKDVGvavaataasamlasnamaIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN
********VTVPTFTGLKAGA*******************LSIKATLKDVGVAVAA***********************SLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKI*****DLLNGPGETYAVTLTEKGTYSFYCSPHQ***********
********VTVPTFTGL***********************LSIKATLKDVGVAVAATAASAMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIP*****************GPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN
MATVTSAAVTVPTFTGLKAGATPARVV***********PKLSIKATLKDVGVAVAATAASAMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN
*************FTGLKAG***************SAVPKLSIKATLKDVGVAVAATAASAMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATVTSAAVTVPTFTGLKAGATPARVVGSTMKASASAVPKLSIKATLKDVGVAVAATAASAMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query168 2.2.26 [Sep-21-2011]
P17340170 Plastocyanin, chloroplast N/A no 1.0 0.988 0.758 1e-65
P00299168 Plastocyanin A, chloropla N/A no 1.0 1.0 0.761 1e-64
P16002168 Plastocyanin, chloroplast N/A no 1.0 1.0 0.696 7e-63
P11970168 Plastocyanin B, chloropla N/A no 1.0 1.0 0.732 5e-62
P11490171 Plastocyanin minor isofor yes no 1.0 0.982 0.684 1e-60
P42699167 Plastocyanin major isofor no no 0.946 0.952 0.681 1e-58
O22646166 Plastocyanin, chloroplast N/A no 0.982 0.993 0.644 2e-57
P07030165 Plastocyanin, chloroplast N/A no 0.976 0.993 0.715 4e-57
P00289168 Plastocyanin, chloroplast N/A no 0.892 0.892 0.735 4e-54
P3547799 Plastocyanin B'/B'' OS=Ni N/A no 0.589 1.0 0.858 1e-46
>sp|P17340|PLAS_SOLLC Plastocyanin, chloroplastic OS=Solanum lycopersicum GN=PETE PE=2 SV=1 Back     alignment and function desciption
 Score =  248 bits (634), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 129/170 (75%), Positives = 151/170 (88%), Gaps = 2/170 (1%)

Query: 1   MATVTSAAVTVPTFTGLKAGATPARVV--GSTMKASASAVPKLSIKATLKDVGVAVAATA 58
           MATVTSAAV +P+FTGLKAGA+ +  V  G++ K +A+ V +L++KA+LKDVG  VAATA
Sbjct: 1   MATVTSAAVAIPSFTGLKAGASSSSRVSTGASAKVAAAPVARLTVKASLKDVGAVVAATA 60

Query: 59  ASAMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSG 118
            SAMLASNAMA+EVLLGGDDGSLAF+P +FSVS+GEKI FKNNAGFPHNVVFDEDEIP+G
Sbjct: 61  VSAMLASNAMALEVLLGGDDGSLAFIPGNFSVSAGEKITFKNNAGFPHNVVFDEDEIPAG 120

Query: 119 VDVSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 168
           VD SKISMS EDLLN  GETY+VTL+EKGTY+FYC+PHQGAGMVG+VTVN
Sbjct: 121 VDASKISMSEEDLLNAAGETYSVTLSEKGTYTFYCAPHQGAGMVGKVTVN 170
Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I.
Solanum lycopersicum (taxid: 4081)
>sp|P00299|PLAS1_POPNI Plastocyanin A, chloroplastic OS=Populus nigra GN=PETE PE=1 SV=2 Back     alignment and function description
>sp|P16002|PLAS_PEA Plastocyanin, chloroplastic OS=Pisum sativum GN=PETE PE=4 SV=1 Back     alignment and function description
>sp|P11970|PLAS2_POPNI Plastocyanin B, chloroplastic OS=Populus nigra GN=PETE PE=1 SV=2 Back     alignment and function description
>sp|P11490|PLAS1_ARATH Plastocyanin minor isoform, chloroplastic OS=Arabidopsis thaliana GN=PETE PE=2 SV=2 Back     alignment and function description
>sp|P42699|PLAS2_ARATH Plastocyanin major isoform, chloroplastic OS=Arabidopsis thaliana GN=DRT112 PE=1 SV=2 Back     alignment and function description
>sp|O22646|PLAS_FRIAG Plastocyanin, chloroplastic OS=Fritillaria agrestis GN=PETE PE=2 SV=1 Back     alignment and function description
>sp|P07030|PLAS_SILPR Plastocyanin, chloroplastic OS=Silene pratensis GN=PETE PE=1 SV=1 Back     alignment and function description
>sp|P00289|PLAS_SPIOL Plastocyanin, chloroplastic OS=Spinacia oleracea GN=PETE PE=1 SV=2 Back     alignment and function description
>sp|P35477|PLAS2_TOBAC Plastocyanin B'/B'' OS=Nicotiana tabacum PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query168
255539076168 Plastocyanin A, chloroplast precursor, p 1.0 1.0 0.773 5e-71
130271170 RecName: Full=Plastocyanin, chloroplasti 1.0 0.988 0.758 5e-64
256860445169 chloroplast plastocyanin precursor [Nico 1.0 0.994 0.781 3e-63
224085958168 predicted protein [Populus trichocarpa] 1.0 1.0 0.761 6e-63
118489947168 unknown [Populus trichocarpa x Populus d 1.0 1.0 0.755 4e-62
118489700168 unknown [Populus trichocarpa x Populus d 1.0 1.0 0.744 2e-61
130275168 RecName: Full=Plastocyanin, chloroplasti 1.0 1.0 0.696 3e-61
351727559165 uncharacterized protein LOC100306554 [Gl 0.982 1.0 0.791 5e-61
224061949168 predicted protein [Populus trichocarpa] 1.0 1.0 0.738 9e-61
1709654168 RecName: Full=Plastocyanin B, chloroplas 1.0 1.0 0.732 3e-60
>gi|255539076|ref|XP_002510603.1| Plastocyanin A, chloroplast precursor, putative [Ricinus communis] gi|223551304|gb|EEF52790.1| Plastocyanin A, chloroplast precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  271 bits (694), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 151/168 (89%)

Query: 1   MATVTSAAVTVPTFTGLKAGATPARVVGSTMKASASAVPKLSIKATLKDVGVAVAATAAS 60
           MATVTSAAV +P+FTGLKA +  +  V ++ K +A ++P++SIKA++K+VGVAV ATAAS
Sbjct: 1   MATVTSAAVAIPSFTGLKAASAASTKVNASAKVAAPSLPRMSIKASMKEVGVAVMATAAS 60

Query: 61  AMLASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVD 120
           AMLASNAMAIE+LLG DDG LAFVP+SFSV+ GEKIVFKNNAGFPHN+VFDEDE+PSGVD
Sbjct: 61  AMLASNAMAIEILLGSDDGGLAFVPNSFSVAPGEKIVFKNNAGFPHNIVFDEDEVPSGVD 120

Query: 121 VSKISMSTEDLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 168
             KISMS EDLLNGPGETYAVTLTEKGTYSFYC+PHQGAGMVG+VTVN
Sbjct: 121 AGKISMSEEDLLNGPGETYAVTLTEKGTYSFYCAPHQGAGMVGKVTVN 168

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|130271|sp|P17340.1|PLAS_SOLLC RecName: Full=Plastocyanin, chloroplastic; Flags: Precursor gi|19300|emb|CAA32121.1| unnamed protein product [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|256860445|gb|ACV32157.1| chloroplast plastocyanin precursor [Nicotiana benthamiana] Back     alignment and taxonomy information
>gi|224085958|ref|XP_002307754.1| predicted protein [Populus trichocarpa] gi|1709651|sp|P00299.2|PLAS1_POPNI RecName: Full=Plastocyanin A, chloroplastic; Flags: Precursor gi|929813|emb|CAA90564.1| plastocyanin a [Populus nigra] gi|222857203|gb|EEE94750.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118489947|gb|ABK96770.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|118489700|gb|ABK96651.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|130275|sp|P16002.1|PLAS_PEA RecName: Full=Plastocyanin, chloroplastic; Flags: Precursor gi|20846|emb|CAA34212.1| unnamed protein product [Pisum sativum] gi|226940|prf||1611464A plastocyanin Back     alignment and taxonomy information
>gi|351727559|ref|NP_001236653.1| uncharacterized protein LOC100306554 [Glycine max] gi|255628865|gb|ACU14777.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224061949|ref|XP_002300679.1| predicted protein [Populus trichocarpa] gi|118487012|gb|ABK95337.1| unknown [Populus trichocarpa] gi|222842405|gb|EEE79952.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|1709654|sp|P11970.2|PLAS2_POPNI RecName: Full=Plastocyanin B, chloroplastic; Flags: Precursor gi|929815|emb|CAA90565.1| plastocyanin b precursor [Populus nigra] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query168
TAIR|locus:2012928167 DRT112 "DNA-DAMAGE-REPAIR/TOLE 0.904 0.910 0.614 2.3e-46
TAIR|locus:2199787171 PETE1 "plastocyanin 1" [Arabid 0.904 0.888 0.612 1.9e-44
UNIPROTKB|O52830139 petE "Plastocyanin" [Nostoc sp 0.565 0.683 0.44 1.1e-16
TAIR|locus:2012928 DRT112 "DNA-DAMAGE-REPAIR/TOLERATION PROTEIN 112" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 486 (176.1 bits), Expect = 2.3e-46, P = 2.3e-46
 Identities = 94/153 (61%), Positives = 112/153 (73%)

Query:    16 GLKAGATPARVVGSTMKASASAVPKLSIKATLKDVGXXXXXXXXXXXXXXXXXXIEVLLG 75
             GLKA    +      ++ +A A PKL++K++LK+ G                  IEVLLG
Sbjct:    16 GLKASTIKSSAT-VRIQTAAVASPKLTVKSSLKNFGVAAVAAAASIALAGNAMAIEVLLG 74

Query:    76 GDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGP 135
             G DGSLAF+P+ FS++ GEKIVFKNNAG+PHNVVFDEDEIPSGVDV+KISM  +DLLNG 
Sbjct:    75 GGDGSLAFIPNDFSIAKGEKIVFKNNAGYPHNVVFDEDEIPSGVDVAKISMDEQDLLNGA 134

Query:   136 GETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 168
             GETY V LTE GTYSFYC+PHQGAGMVG+VTVN
Sbjct:   135 GETYEVALTEPGTYSFYCAPHQGAGMVGKVTVN 167
GO:0005507 "copper ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009543 "chloroplast thylakoid lumen" evidence=IDA
GO:0031977 "thylakoid lumen" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0046688 "response to copper ion" evidence=IEP
GO:0055070 "copper ion homeostasis" evidence=IMP
GO:0017148 "negative regulation of translation" evidence=IMP
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0000271 "polysaccharide biosynthetic process" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006417 "regulation of translation" evidence=RCA
GO:0009637 "response to blue light" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0009657 "plastid organization" evidence=RCA
GO:0009744 "response to sucrose stimulus" evidence=RCA
GO:0009825 "multidimensional cell growth" evidence=RCA
GO:0009932 "cell tip growth" evidence=RCA
GO:0009965 "leaf morphogenesis" evidence=RCA
GO:0010114 "response to red light" evidence=RCA
GO:0010155 "regulation of proton transport" evidence=RCA
GO:0010218 "response to far red light" evidence=RCA
GO:0010817 "regulation of hormone levels" evidence=RCA
GO:0019344 "cysteine biosynthetic process" evidence=RCA
GO:0030154 "cell differentiation" evidence=RCA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
GO:0043481 "anthocyanin accumulation in tissues in response to UV light" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
GO:0048767 "root hair elongation" evidence=RCA
GO:0071555 "cell wall organization" evidence=RCA
GO:0009411 "response to UV" evidence=IGI
TAIR|locus:2199787 PETE1 "plastocyanin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O52830 petE "Plastocyanin" [Nostoc sp. PCC 7119 (taxid:1168)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P08248PLAS_HORVUNo assigned EC number0.55290.91070.9870N/Ano
P17340PLAS_SOLLCNo assigned EC number0.75881.00.9882N/Ano
Q0DFC9PLAS_ORYSJNo assigned EC number0.54430.91070.9935yesno
P00299PLAS1_POPNINo assigned EC number0.76191.01.0N/Ano
P16002PLAS_PEANo assigned EC number0.69641.01.0N/Ano
P07030PLAS_SILPRNo assigned EC number0.71590.97610.9939N/Ano
P11970PLAS2_POPNINo assigned EC number0.73211.01.0N/Ano
P18068PLAS_CHLRENo assigned EC number0.51350.80350.9310N/Ano
P00289PLAS_SPIOLNo assigned EC number0.73580.89280.8928N/Ano
P11490PLAS1_ARATHNo assigned EC number0.68421.00.9824yesno
A2Y886PLAS_ORYSINo assigned EC number0.54430.91070.9935N/Ano
O22646PLAS_FRIAGNo assigned EC number0.64490.98210.9939N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
grail3.0002074001
hypothetical protein (169 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_Genewise1_v1.C_LG_II4195
SubName- Full=Putative uncharacterized protein; (140 aa)
   •  • 0.593
fgenesh4_pg.C_scaffold_1452000002
Predicted protein (158 aa)
      • 0.471
eugene3.02800004
photosystem I subunit VII (81 aa)
      • 0.456
estExt_fgenesh4_pg.C_LG_VI0422
SubName- Full=Putative uncharacterized protein; (1365 aa)
   •  • 0.416
estExt_Genewise1_v1.C_LG_I8285
SubName- Full=Putative uncharacterized protein; (224 aa)
   •  • 0.412
eugene3.00081422
SubName- Full=Putative uncharacterized protein; (205 aa)
   •  • 0.409
eugene3.00100819
SubName- Full=Putative uncharacterized protein; (202 aa)
   •  • 0.409
estExt_fgenesh4_pg.C_LG_I0883
hypothetical protein (277 aa)
  •     0.403

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
TIGR0265699 TIGR02656, cyanin_plasto, plastocyanin 2e-47
pfam0012799 pfam00127, Copper-bind, Copper binding proteins, p 9e-47
PRK02710119 PRK02710, PRK02710, plastocyanin; Provisional 6e-31
COG3794128 COG3794, PetE, Plastocyanin [Energy production and 1e-19
TIGR03102115 TIGR03102, halo_cynanin, halocyanin domain 1e-08
COG4454158 COG4454, COG4454, Uncharacterized copper-binding p 5e-08
TIGR02375116 TIGR02375, pseudoazurin, pseudoazurin 8e-07
TIGR0265783 TIGR02657, amicyanin, amicyanin 6e-04
>gnl|CDD|233964 TIGR02656, cyanin_plasto, plastocyanin Back     alignment and domain information 
 Score =  149 bits (377), Expect = 2e-47
 Identities = 52/99 (52%), Positives = 72/99 (72%)

Query: 70  IEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTE 129
           + V +G D G+L F P+  S+++G+ + + NN G PHNVVFDED +P+GV     S+S +
Sbjct: 1   VTVKMGADKGALVFEPAKISIAAGDTVEWVNNKGGPHNVVFDEDAVPAGVKELAKSLSHK 60

Query: 130 DLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 168
           DLLN PGE+Y VT +  GTY+FYC PH+GAGMVG++TV 
Sbjct: 61  DLLNSPGESYEVTFSTPGTYTFYCEPHRGAGMVGKITVE 99

Members of this family are plastocyanin, a blue copper protein related to pseudoazurin, halocyanin, amicyanin, etc. This protein, located in the thylakoid luman, performs electron transport to photosystem I in Cyanobacteria and chloroplasts [Energy metabolism, Electron transport, Energy metabolism, Photosynthesis]. Length = 99
>gnl|CDD|215736 pfam00127, Copper-bind, Copper binding proteins, plastocyanin/azurin family Back     alignment and domain information
>gnl|CDD|235060 PRK02710, PRK02710, plastocyanin; Provisional Back     alignment and domain information
>gnl|CDD|226317 COG3794, PetE, Plastocyanin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|132146 TIGR03102, halo_cynanin, halocyanin domain Back     alignment and domain information
>gnl|CDD|226861 COG4454, COG4454, Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131428 TIGR02375, pseudoazurin, pseudoazurin Back     alignment and domain information
>gnl|CDD|131705 TIGR02657, amicyanin, amicyanin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 168
PRK02710119 plastocyanin; Provisional 99.96
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 99.96
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 99.94
COG3794128 PetE Plastocyanin [Energy production and conversio 99.93
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 99.91
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 99.9
TIGR0265783 amicyanin amicyanin. Members of this family are am 99.88
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 99.79
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 99.56
TIGR02695125 azurin azurin. Azurin is a blue copper-binding pro 99.51
COG4454158 Uncharacterized copper-binding protein [Inorganic 99.5
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 99.37
PRK10378 375 inactive ferrous ion transporter periplasmic prote 99.31
PLN03148167 Blue copper-like protein; Provisional 99.2
PRK02888635 nitrous-oxide reductase; Validated 99.12
COG3241151 Azurin [Energy production and conversion] 98.8
TIGR02376 311 Cu_nitrite_red nitrite reductase, copper-containin 98.65
TIGR01480 587 copper_res_A copper-resistance protein, CopA famil 98.62
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 98.59
PF00116120 COX2: Cytochrome C oxidase subunit II, periplasmic 98.59
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 98.57
PF0229885 Cu_bind_like: Plastocyanin-like domain; InterPro: 98.57
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 98.41
PLN02604 566 oxidoreductase 98.37
TIGR01480587 copper_res_A copper-resistance protein, CopA famil 98.17
PRK10965 523 multicopper oxidase; Provisional 98.17
TIGR02866201 CoxB cytochrome c oxidase, subunit II. Cytochrome 98.14
PRK10883 471 FtsI repressor; Provisional 98.09
COG1622247 CyoA Heme/copper-type cytochrome/quinol oxidases, 98.05
PLN02354 552 copper ion binding / oxidoreductase 98.05
PLN02835 539 oxidoreductase 97.93
TIGR03388 541 ascorbase L-ascorbate oxidase, plant type. Members 97.85
PLN00044 596 multi-copper oxidase-related protein; Provisional 97.78
PLN02191 574 L-ascorbate oxidase 97.69
TIGR03389 539 laccase laccase, plant. Members of this protein fa 97.67
PLN02168 545 copper ion binding / pectinesterase 97.67
PF07731138 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR01 97.54
PLN02991 543 oxidoreductase 97.47
TIGR03390 538 ascorbOXfungal L-ascorbate oxidase, fungal type. T 97.36
PLN02792 536 oxidoreductase 97.34
MTH00047194 COX2 cytochrome c oxidase subunit II; Provisional 97.27
COG2132 451 SufI Putative multicopper oxidases [Secondary meta 97.17
MTH00140228 COX2 cytochrome c oxidase subunit II; Provisional 97.05
TIGR01433226 CyoA cytochrome o ubiquinol oxidase subunit II. Th 96.98
COG4263637 NosZ Nitrous oxide reductase [Energy production an 96.88
PTZ00047162 cytochrome c oxidase subunit II; Provisional 96.75
MTH00008228 COX2 cytochrome c oxidase subunit II; Validated 96.63
PRK10965523 multicopper oxidase; Provisional 96.53
MTH00098227 COX2 cytochrome c oxidase subunit II; Validated 96.52
MTH00129230 COX2 cytochrome c oxidase subunit II; Provisional 96.44
KOG1263 563 consensus Multicopper oxidases [Secondary metaboli 96.43
TIGR01432217 QOXA cytochrome aa3 quinol oxidase, subunit II. Th 96.43
MTH00051234 COX2 cytochrome c oxidase subunit II; Provisional 96.38
MTH00023240 COX2 cytochrome c oxidase subunit II; Validated 96.35
MTH00139226 COX2 cytochrome c oxidase subunit II; Provisional 96.34
MTH00168225 COX2 cytochrome c oxidase subunit II; Provisional 96.31
MTH00154227 COX2 cytochrome c oxidase subunit II; Provisional 96.29
PRK10525315 cytochrome o ubiquinol oxidase subunit II; Provisi 96.24
COG2132451 SufI Putative multicopper oxidases [Secondary meta 96.19
MTH00038229 COX2 cytochrome c oxidase subunit II; Provisional 96.18
MTH00117227 COX2 cytochrome c oxidase subunit II; Provisional 96.06
PRK10883471 FtsI repressor; Provisional 95.84
MTH00076228 COX2 cytochrome c oxidase subunit II; Provisional 95.71
MTH00185230 COX2 cytochrome c oxidase subunit II; Provisional 95.66
MTH00080231 COX2 cytochrome c oxidase subunit II; Provisional 95.39
MTH00027262 COX2 cytochrome c oxidase subunit II; Provisional 95.26
COG4633 272 Plastocyanin domain containing protein [General fu 95.15
TIGR02376311 Cu_nitrite_red nitrite reductase, copper-containin 94.43
PF00394159 Cu-oxidase: Multicopper oxidase; InterPro: IPR0011 94.15
PLN02835539 oxidoreductase 93.89
PF1051826 TAT_signal: TAT (twin-arginine translocation) path 89.62
PLN02792536 oxidoreductase 89.35
PF05753181 TRAP_beta: Translocon-associated protein beta (TRA 88.31
COG4263637 NosZ Nitrous oxide reductase [Energy production an 88.21
PLN02168545 copper ion binding / pectinesterase 87.11
TIGR03389539 laccase laccase, plant. Members of this protein fa 86.91
PLN02354552 copper ion binding / oxidoreductase 86.75
PLN02991543 oxidoreductase 84.91
PRK05089188 cytochrome C oxidase assembly protein; Provisional 84.68
PF1063378 NPCBM_assoc: NPCBM-associated, NEW3 domain of alph 84.68
TIGR03388541 ascorbase L-ascorbate oxidase, plant type. Members 82.47
PF14874102 PapD-like: Flagellar-associated PapD-like 82.09
>PRK02710 plastocyanin; Provisional Back     alignment and domain information 
Probab=99.96  E-value=8.4e-28  Score=179.04  Aligned_cols=96  Identities=45%  Similarity=0.850  Sum_probs=83.2

Q ss_pred             hcccceEEEEEEeecCCCceEeCCeEEEcCCCEEEEEeCCCCCeeEEEccCCCCCCccccccccccCccccCCCceEEEE
Q 030950           63 LASNAMAIEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVT  142 (168)
Q Consensus        63 laa~a~t~~V~~~~~~g~~~F~P~~itV~~GdtV~f~N~d~~~Hnv~~~~~~~P~g~~~~~~~~~~~~~~i~pG~t~svt  142 (168)
                      .++.+.+++|+|+.+++++.|+|+.|+|++||+|+|+|.+..+||++++...   ..       .+.++.+.||++++++
T Consensus        24 ~~a~a~~~~V~~~~~~~~~~F~P~~i~v~~Gd~V~~~N~~~~~H~v~~~~~~---~~-------~~~~~~~~pg~t~~~t   93 (119)
T PRK02710         24 SSASAETVEVKMGSDAGMLAFEPSTLTIKAGDTVKWVNNKLAPHNAVFDGAK---EL-------SHKDLAFAPGESWEET   93 (119)
T ss_pred             cccccceEEEEEccCCCeeEEeCCEEEEcCCCEEEEEECCCCCceEEecCCc---cc-------cccccccCCCCEEEEE
Confidence            4557889999999877889999999999999999999999899999986421   11       1344567899999999


Q ss_pred             eCCceeEEEEcCCCCCCCcEEEEEeC
Q 030950          143 LTEKGTYSFYCSPHQGAGMVGQVTVN  168 (168)
Q Consensus       143 F~~pG~Y~y~C~~H~~~GM~G~I~V~  168 (168)
                      |++||+|.|||++|+++||+|+|+|+
T Consensus        94 F~~~G~y~y~C~~H~~~gM~G~I~V~  119 (119)
T PRK02710         94 FSEAGTYTYYCEPHRGAGMVGKITVE  119 (119)
T ss_pred             ecCCEEEEEEcCCCccCCcEEEEEEC
Confidence            99999999999999999999999996

>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>TIGR02695 azurin azurin Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>PRK10378 inactive ferrous ion transporter periplasmic protein EfeO; Provisional Back     alignment and domain information
>PLN03148 Blue copper-like protein; Provisional Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG3241 Azurin [Energy production and conversion] Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>TIGR01480 copper_res_A copper-resistance protein, CopA family Back     alignment and domain information
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PF00116 COX2: Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>PF02298 Cu_bind_like: Plastocyanin-like domain; InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>TIGR01480 copper_res_A copper-resistance protein, CopA family Back     alignment and domain information
>PRK10965 multicopper oxidase; Provisional Back     alignment and domain information
>TIGR02866 CoxB cytochrome c oxidase, subunit II Back     alignment and domain information
>PRK10883 FtsI repressor; Provisional Back     alignment and domain information
>COG1622 CyoA Heme/copper-type cytochrome/quinol oxidases, subunit 2 [Energy production and conversion] Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>PLN02835 oxidoreductase Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>PLN00044 multi-copper oxidase-related protein; Provisional Back     alignment and domain information
>PLN02191 L-ascorbate oxidase Back     alignment and domain information
>TIGR03389 laccase laccase, plant Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>PF07731 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR011706 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PLN02991 oxidoreductase Back     alignment and domain information
>TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type Back     alignment and domain information
>PLN02792 oxidoreductase Back     alignment and domain information
>MTH00047 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>MTH00140 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>TIGR01433 CyoA cytochrome o ubiquinol oxidase subunit II Back     alignment and domain information
>COG4263 NosZ Nitrous oxide reductase [Energy production and conversion] Back     alignment and domain information
>PTZ00047 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>MTH00008 COX2 cytochrome c oxidase subunit II; Validated Back     alignment and domain information
>PRK10965 multicopper oxidase; Provisional Back     alignment and domain information
>MTH00098 COX2 cytochrome c oxidase subunit II; Validated Back     alignment and domain information
>MTH00129 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>KOG1263 consensus Multicopper oxidases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01432 QOXA cytochrome aa3 quinol oxidase, subunit II Back     alignment and domain information
>MTH00051 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>MTH00023 COX2 cytochrome c oxidase subunit II; Validated Back     alignment and domain information
>MTH00139 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>MTH00168 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>MTH00154 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>PRK10525 cytochrome o ubiquinol oxidase subunit II; Provisional Back     alignment and domain information
>COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>MTH00038 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>MTH00117 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>PRK10883 FtsI repressor; Provisional Back     alignment and domain information
>MTH00076 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>MTH00185 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>MTH00080 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>MTH00027 COX2 cytochrome c oxidase subunit II; Provisional Back     alignment and domain information
>COG4633 Plastocyanin domain containing protein [General function prediction only] Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>PF00394 Cu-oxidase: Multicopper oxidase; InterPro: IPR001117 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>PLN02835 oxidoreductase Back     alignment and domain information
>PF10518 TAT_signal: TAT (twin-arginine translocation) pathway signal sequence; InterPro: IPR019546 The twin-arginine translocation (Tat) pathway serves the role of transporting folded proteins across energy-transducing membranes [] Back     alignment and domain information
>PLN02792 oxidoreductase Back     alignment and domain information
>PF05753 TRAP_beta: Translocon-associated protein beta (TRAPB); InterPro: IPR008856 This family consists of several eukaryotic translocon-associated protein beta (TRAPB) or signal sequence receptor beta subunit (SSR-beta) proteins Back     alignment and domain information
>COG4263 NosZ Nitrous oxide reductase [Energy production and conversion] Back     alignment and domain information
>PLN02168 copper ion binding / pectinesterase Back     alignment and domain information
>TIGR03389 laccase laccase, plant Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information
>PLN02991 oxidoreductase Back     alignment and domain information
>PRK05089 cytochrome C oxidase assembly protein; Provisional Back     alignment and domain information
>PF10633 NPCBM_assoc: NPCBM-associated, NEW3 domain of alpha-galactosidase; InterPro: IPR018905 This domain has been named NEW3, but its function is not known Back     alignment and domain information
>TIGR03388 ascorbase L-ascorbate oxidase, plant type Back     alignment and domain information
>PF14874 PapD-like: Flagellar-associated PapD-like Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
1ag6_A99 Plastocyanin From Spinach Length = 99 4e-47
1oow_A99 The Crystal Structure Of The Spinach Plastocyanin D 2e-46
2pcf_A99 The Complex Of Cytochrome F And Plastocyanin Determ 3e-46
1tef_A99 Crystal Structure Of The Spinach Plastocyanin Mutan 1e-45
1teg_A99 Crystal Structure Of The Spinach Plastocyanin Mutan 9e-45
1tkw_A99 The Transient Complex Of Poplar Plastocyanin With T 1e-43
9pcy_A99 High-Resolution Solution Structure Of Reduced Frenc 5e-43
4dp0_X99 The 1.5 Angstrom Crystal Structure Of Oxidized (cui 1e-42
1jxg_A100 The 1.6 A Resolution Crystal Structure Of A Mutant 2e-42
1byo_A99 Wild-Type Plastocyanin From Silene Length = 99 1e-41
1byp_A99 E43k,D44k Double Mutant Plastocyanin From Silene Le 2e-40
1pla_A97 High-Resolution Solution Structure Of Reduced Parsl 1e-36
2plt_A98 Structure Determination Of Plastocyanin From A Crys 6e-30
7pcy_A98 The Crystal Structure Of Plastocyanin From A Green 2e-27
1iuz_A98 Plastocyanin Length = 98 5e-27
1pcs_A98 The 2.15 A Crystal Structure Of A Triple Mutant Pla 5e-20
1jxd_A98 Solution Structure Of Reduced Cu(i) Plastocyanin Fr 5e-18
1jxf_A98 Solution Structure Of Reduced Cu(I) Plastocyanin Fr 5e-18
2w88_A106 Plastocyanin Variant With N-Terminal Methionine - O 6e-18
1m9w_A98 Study Of Electrostatic Potential Surface Distributi 6e-18
1baw_A105 Plastocyanin From Phormidium Laminosum Length = 105 6e-18
1bxu_A91 Oxidized Plastocyanin From Synechococcus Sp. Length 9e-18
3cvb_A105 Regulation Of Protein Function: Crystal Packing Int 2e-17
2jxm_A97 Ensemble Of Twenty Structures Of The Prochlorothrix 7e-17
1b3i_A97 Nmr Solution Structure Of Plastocyanin From The Pho 8e-17
3bqv_A105 Crystal Structure Of The Double Mutant D44a D45a Pl 9e-17
2gim_A106 1.6 Angstrom Structure Of Plastocyanin From Anabaen 1e-16
1fa4_A105 Elucidation Of The Paramagnetic Relaxation Of Heter 1e-16
2bz7_A102 Oxidized And Reduced Structures Of A Mutant Plastoc 6e-13
1kdi_A102 Reduced Form Of Plastocyanin From Dryopteris Crassi 1e-11
1bqk_A124 Oxidized Pseudoazurin Length = 124 8e-09
2jkw_A124 Pseudoazurin M16f Length = 124 1e-08
1adw_A123 Pseudoazurin Length = 123 1e-06
3c75_A132 Paracoccus Versutus Methylamine Dehydrogenase In Co 2e-06
1id2_A106 Crystal Structure Of Amicyanin From Paracoccus Vers 3e-06
1paz_A123 Refinement Of The Structure Of Pseudoazurin From Al 6e-06
2ux6_A122 Pseudoazurin With Engineered Amicyanin Ligand Loop, 7e-06
1py0_A125 Crystal Structure Of E51cE54C PSAZ FROM A.FAECALIS 2e-05
3tu6_A127 The Structure Of A Pseudoazurin From Sinorhizobium 5e-05
4paz_A123 Oxidized Mutant P80a Pseudoazurin From A. Faecalis 8e-05
3ply_A105 Structure Of Oxidized P96g Mutant Of Amicyanin Leng 1e-04
6paz_A123 Oxidized Mutant P80i Pseudoazurin From A. Faecalis 1e-04
2mta_A105 Crystal Structure Of A Ternary Electron Transfer Co 1e-04
1mda_A103 Crystal Structure Of An Electron-Transfer Complex B 1e-04
2idq_A105 Structure Of M98a Mutant Of Amicyanin, Cu(Ii) Lengt 2e-04
3rym_A105 Structure Of Oxidized M98k Mutant Of Amicyanin Leng 2e-04
3ie9_A105 Structure Of Oxidized M98l Mutant Of Amicyanin Leng 2e-04
2idt_A105 Structure Of M98q Mutant Of Amicyanin, Cu(Ii) Lengt 4e-04
2hx7_A127 Crystal Structure Of Cu(ii) Azurin With The Metal-b 6e-04
2qdw_A106 Structure Of The Cu(Ii) Form Of The M51a Mutant Of 7e-04
>pdb|1AG6|A Chain A, Plastocyanin From Spinach Length = 99 Back     alignment and structure 
Iteration: 1

 Score =  183 bits (465), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 86/99 (86%), Positives = 92/99 (92%)
Query: 70  IEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTE 129
           +EVLLGGDDGSLAF+P  FSV+SGE+IVFKNNAGFPHNVVFDEDEIPSGVD +KISMS E
Sbjct: 1   VEVLLGGDDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEE 60
Query: 130 DLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 168
           DLLN PGETY VTLTEKGTY FYCSPHQGAGMVG+VTVN
Sbjct: 61  DLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN 99
>pdb|1OOW|A Chain A, The Crystal Structure Of The Spinach Plastocyanin Double Mutant G8dL12E GIVES INSIGHT INTO ITS LOW REACTIVITY Towards Photosystem 1 And Cytochrome F Length = 99 Back     alignment and structure
>pdb|2PCF|A Chain A, The Complex Of Cytochrome F And Plastocyanin Determined With Paramagnetic Nmr. Based On The Structures Of Cytochrome F And Plastocyanin, 10 Structures Length = 99 Back     alignment and structure
>pdb|1TEF|A Chain A, Crystal Structure Of The Spinach Plastocyanin Mutants G8dK30CT69C AND K30CT69C- A Study Of The Effect On Crystal Packing And Thermostability From The Introduction Of A Novel Disulfide Bond Length = 99 Back     alignment and structure
>pdb|1TEG|A Chain A, Crystal Structure Of The Spinach Plastocyanin Mutants G8dK30CT69C And K30cT69C- A Study Of The Effect On Crystal Packing And Thermostability From The Introduction Of A Novel Disulfide Bond Length = 99 Back     alignment and structure
>pdb|1TKW|A Chain A, The Transient Complex Of Poplar Plastocyanin With Turnip Cytochrome F Determined With Paramagnetic Nmr Length = 99 Back     alignment and structure
>pdb|9PCY|A Chain A, High-Resolution Solution Structure Of Reduced French Bean Plastocyanin And Comparison With The Crystal Structure Of Poplar Plastocyanin Length = 99 Back     alignment and structure
>pdb|4DP0|X Chain X, The 1.5 Angstrom Crystal Structure Of Oxidized (cuii) Poplar Plastocyanin B At Ph 4.0 Length = 99 Back     alignment and structure
>pdb|1JXG|A Chain A, The 1.6 A Resolution Crystal Structure Of A Mutant Poplar Plastocyanin Bearing A 21-25 Engeneered Disulfide Bridge Length = 100 Back     alignment and structure
>pdb|1BYO|A Chain A, Wild-Type Plastocyanin From Silene Length = 99 Back     alignment and structure
>pdb|1BYP|A Chain A, E43k,D44k Double Mutant Plastocyanin From Silene Length = 99 Back     alignment and structure
>pdb|1PLA|A Chain A, High-Resolution Solution Structure Of Reduced Parsley Plastocyanin Length = 97 Back     alignment and structure
>pdb|2PLT|A Chain A, Structure Determination Of Plastocyanin From A Crystal Specimen With Hemihedral Twinning Fraction Of One-Half Length = 98 Back     alignment and structure
>pdb|7PCY|A Chain A, The Crystal Structure Of Plastocyanin From A Green Alga, Enteromorpha Prolifera Length = 98 Back     alignment and structure
>pdb|1IUZ|A Chain A, Plastocyanin Length = 98 Back     alignment and structure
>pdb|1PCS|A Chain A, The 2.15 A Crystal Structure Of A Triple Mutant Plastocyanin From The Cyanobacterium Synechocystis Sp. Pcc 6803 Length = 98 Back     alignment and structure
>pdb|1JXD|A Chain A, Solution Structure Of Reduced Cu(i) Plastocyanin From Synechocystis Pcc6803 Length = 98 Back     alignment and structure
>pdb|1JXF|A Chain A, Solution Structure Of Reduced Cu(I) Plastocyanin From Synechocystis Pcc6803 Length = 98 Back     alignment and structure
>pdb|2W88|A Chain A, Plastocyanin Variant With N-Terminal Methionine - Open Structure Length = 106 Back     alignment and structure
>pdb|1M9W|A Chain A, Study Of Electrostatic Potential Surface Distribution Using High Resolution Side-Chain Conformation Determined By Nmr Length = 98 Back     alignment and structure
>pdb|1BAW|A Chain A, Plastocyanin From Phormidium Laminosum Length = 105 Back     alignment and structure
>pdb|1BXU|A Chain A, Oxidized Plastocyanin From Synechococcus Sp. Length = 91 Back     alignment and structure
>pdb|3CVB|A Chain A, Regulation Of Protein Function: Crystal Packing Interfaces And Conformational Dimerization Length = 105 Back     alignment and structure
>pdb|2JXM|A Chain A, Ensemble Of Twenty Structures Of The Prochlorothrix Hollandica Plastocyanin- Cytochrome F Complex Length = 97 Back     alignment and structure
>pdb|1B3I|A Chain A, Nmr Solution Structure Of Plastocyanin From The Photosynthetic Prokaryote, Prochlorothrix Hollandica (Minimized Average Structure) Length = 97 Back     alignment and structure
>pdb|3BQV|A Chain A, Crystal Structure Of The Double Mutant D44a D45a Plastocyanin From Phormidium Laminosum Length = 105 Back     alignment and structure
>pdb|2GIM|A Chain A, 1.6 Angstrom Structure Of Plastocyanin From Anabaena Variabilis Length = 106 Back     alignment and structure
>pdb|1FA4|A Chain A, Elucidation Of The Paramagnetic Relaxation Of Heteronuclei And Protons In Cu(Ii) Plastocyanin From Anabaena Variabilis Length = 105 Back     alignment and structure
>pdb|2BZ7|A Chain A, Oxidized And Reduced Structures Of A Mutant Plastocyanin Of Fern Length = 102 Back     alignment and structure
>pdb|1KDI|A Chain A, Reduced Form Of Plastocyanin From Dryopteris Crassirhizoma Length = 102 Back     alignment and structure
>pdb|1BQK|A Chain A, Oxidized Pseudoazurin Length = 124 Back     alignment and structure
>pdb|2JKW|A Chain A, Pseudoazurin M16f Length = 124 Back     alignment and structure
>pdb|1ADW|A Chain A, Pseudoazurin Length = 123 Back     alignment and structure
>pdb|3C75|A Chain A, Paracoccus Versutus Methylamine Dehydrogenase In Complex With Amicyanin Length = 132 Back     alignment and structure
>pdb|1ID2|A Chain A, Crystal Structure Of Amicyanin From Paracoccus Versutus (Thiobacillus Versutus) Length = 106 Back     alignment and structure
>pdb|1PAZ|A Chain A, Refinement Of The Structure Of Pseudoazurin From Alcaligenes Faecalis S-6 At 1.55 Angstroms Resolution Length = 123 Back     alignment and structure
>pdb|2UX6|A Chain A, Pseudoazurin With Engineered Amicyanin Ligand Loop, Oxidized Form, Ph 7.5 Length = 122 Back     alignment and structure
>pdb|1PY0|A Chain A, Crystal Structure Of E51cE54C PSAZ FROM A.FAECALIS WITH Clanp Probe Length = 125 Back     alignment and structure
>pdb|3TU6|A Chain A, The Structure Of A Pseudoazurin From Sinorhizobium Meliltoi Length = 127 Back     alignment and structure
>pdb|4PAZ|A Chain A, Oxidized Mutant P80a Pseudoazurin From A. Faecalis Length = 123 Back     alignment and structure
>pdb|3PLY|A Chain A, Structure Of Oxidized P96g Mutant Of Amicyanin Length = 105 Back     alignment and structure
>pdb|6PAZ|A Chain A, Oxidized Mutant P80i Pseudoazurin From A. Faecalis Length = 123 Back     alignment and structure
>pdb|2MTA|A Chain A, Crystal Structure Of A Ternary Electron Transfer Complex Between Methylamine Dehydrogenase, Amicyanin And A C-Type Cytochrome Length = 105 Back     alignment and structure
>pdb|1MDA|A Chain A, Crystal Structure Of An Electron-Transfer Complex Between Methylamine Dehydrogenase And Amicyanin Length = 103 Back     alignment and structure
>pdb|2IDQ|A Chain A, Structure Of M98a Mutant Of Amicyanin, Cu(Ii) Length = 105 Back     alignment and structure
>pdb|3RYM|A Chain A, Structure Of Oxidized M98k Mutant Of Amicyanin Length = 105 Back     alignment and structure
>pdb|3IE9|A Chain A, Structure Of Oxidized M98l Mutant Of Amicyanin Length = 105 Back     alignment and structure
>pdb|2IDT|A Chain A, Structure Of M98q Mutant Of Amicyanin, Cu(Ii) Length = 105 Back     alignment and structure
>pdb|2HX7|A Chain A, Crystal Structure Of Cu(ii) Azurin With The Metal-binding Loop Sequence "ctfpghsalm" Replaced With "csphqgagm" Length = 127 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query168
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 6e-39
1byp_A99 Protein (plastocyanin); electron transfer, photosy 3e-37
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 2e-33
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 3e-32
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 4e-32
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 8e-32
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 8e-31
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 2e-30
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 8e-29
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 1e-28
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 1e-26
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 3e-24
3c75_A132 Amicyanin; copper proteins, electron transfer comp 1e-23
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 9e-23
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 2e-21
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 2e-20
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 2e-19
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 7e-19
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 1e-16
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 5e-14
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 2e-13
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 1e-11
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 5e-10
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 3e-08
2cal_A154 Rusticyanin; iron respiratory electron transport c 3e-06
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 4e-06
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 1e-05
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 3e-05
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 7e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 2e-04
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Length = 99 Back     alignment and structure
 Score =  127 bits (320), Expect = 6e-39
 Identities = 81/99 (81%), Positives = 87/99 (87%)

Query: 70  IEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTE 129
           I+VLLG DDGSLAFVPS FS+S GEKIVFKNNAGFPHN+VFDED IPSGVD SKISMS E
Sbjct: 1   IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEE 60

Query: 130 DLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 168
           DLLN  GET+ V L+ KG YSFYCSPHQGAGMVG+VTVN
Sbjct: 61  DLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN 99
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Length = 99 Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Length = 98 Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Length = 98 Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Length = 102 Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Length = 105 Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Length = 98 Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Length = 91 Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Length = 106 Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Length = 97 Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Length = 105 Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Length = 106 Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Length = 132 Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Length = 123 Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Length = 123 Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} PDB: 1adw_A Length = 123 Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Length = 127 Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} Length = 124 Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Length = 122 Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Length = 139 Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Length = 167 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Length = 140 Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Length = 129 Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Length = 128 Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Length = 154 Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Length = 112 Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Length = 125 Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Length = 129 Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Length = 128 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query168
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 99.95
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 99.95
1byp_A99 Protein (plastocyanin); electron transfer, photosy 99.95
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 99.94
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 99.94
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 99.94
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 99.94
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 99.93
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 99.92
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 99.92
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 99.92
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 99.92
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 99.92
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 99.92
3c75_A132 Amicyanin; copper proteins, electron transfer comp 99.91
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 99.89
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 99.89
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 99.89
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 99.89
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 99.88
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 99.79
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 99.78
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 99.76
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 99.76
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 99.76
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 99.75
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 99.75
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 99.74
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 99.65
2cal_A154 Rusticyanin; iron respiratory electron transport c 99.56
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 99.52
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 99.34
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 99.34
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 99.24
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 99.23
1jer_A138 Cucumber stellacyanin; electron transport, copper, 99.08
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 99.06
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 99.03
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 99.03
2cbp_A96 Cucumber basic protein; electron transport, phytoc 99.01
1kbv_A 327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 98.58
1oe1_A 336 Dissimilatory copper-containing nitrite reductase; 98.54
3cg8_A 343 Laccase; oxidoreductase, multicopper blue protein; 98.48
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 98.44
1mzy_A 333 Copper-containing nitrite reductase; mutant M182T, 98.37
3gdc_A 288 Multicopper oxidase; beta sandwich, plasmid, oxido 98.37
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 98.29
2bw4_A 340 Copper-containing nitrite reductase; oxidoreductas 98.27
3g5w_A 318 Multicopper oxidase type 1; two domain, laccase, n 98.25
3t9w_A 299 Small laccase, multi-copper oxidase; two-domain co 98.16
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 98.15
2zwn_A 339 Two-domain type laccase; muticopper oxidase, oxido 98.15
2xu9_A 439 Laccase; oxidoreductase, multicopper oxidases; 1.5 98.15
3tas_A 313 Small laccase, multi-copper oxidase; two-domain la 98.1
1v10_A 521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 98.1
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 98.04
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 98.02
2uxt_A 451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 98.02
1aoz_A 552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 98.0
1hfu_A 503 Laccase 1; oxidoreductase, blue multi-copper oxida 97.99
3tas_A313 Small laccase, multi-copper oxidase; two-domain la 97.97
3t9w_A299 Small laccase, multi-copper oxidase; two-domain co 97.96
1cyx_A205 CYOA; electron transport; 2.30A {Escherichia coli} 97.94
2q9o_A 559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 97.94
3zx1_A 481 Oxidoreductase, putative; laccase, metallo-oxidase 97.92
3aw5_A 448 Multicopper oxidase; beta barrel, oxidoreductase; 97.9
3zx1_A481 Oxidoreductase, putative; laccase, metallo-oxidase 97.87
3abg_A 534 Bilirubin oxidase; cleavage on PAIR of basic resid 97.84
1zpu_A 534 Iron transport multicopper oxidase FET3; ferroxida 97.82
3t6v_A 495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 97.81
3sqr_A 580 Laccase; multicopper oxidase, glycosylation, oxido 97.81
3pxl_A 499 Laccase; 4-copper protein, metal-binding, oxidored 97.76
3kw8_A 276 Laccase, putative copper oxidase; two-domain lacca 97.72
1sdd_A 306 Coagulation factor V; copper-binding protein, cofa 97.71
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 97.68
3od3_A 488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 97.65
2g23_A 612 PHS, phenoxazinone synthase; copper, metalloprotei 97.63
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 97.57
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 97.56
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 97.53
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 97.51
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 97.49
3hb3_B298 Cytochrome C oxidase subunit 2; electron transfer, 97.48
2gsm_B262 Cytochrome C oxidase subunit 2; transmembrane prot 97.35
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 97.34
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 97.34
2wsd_A 513 Spore coat protein A; oxidoreductase, multi-copper 97.34
1v54_B227 Cytochrome C oxidase polypeptide II; oxidoreductas 97.26
2j5w_A 1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 97.25
2g23_A612 PHS, phenoxazinone synthase; copper, metalloprotei 97.24
1fft_B315 Ubiquinol oxidase; electron transport, cytochrome 97.2
2xu9_A439 Laccase; oxidoreductase, multicopper oxidases; 1.5 97.11
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 97.08
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 97.06
2r7e_A 742 Coagulation factor VIII; ceruloplasmin fold, cuppe 97.01
2j5w_A1065 Ceruloplasmin, ferroxidase; oxidoreductase, plasma 96.98
3gyr_A 612 PHS, phenoxazinone synthase; metalloprotein, lacca 96.88
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 96.84
3od3_A488 Blue copper oxidase CUEO; multicopper oxidase, Cu( 96.76
2wsd_A513 Spore coat protein A; oxidoreductase, multi-copper 96.67
2zoo_A 442 Probable nitrite reductase; electron transfer, ele 96.61
1zpu_A534 Iron transport multicopper oxidase FET3; ferroxida 96.18
1v10_A521 Laccase; multicopper blue oxidase, oxidase; 1.7A { 95.98
3abg_A534 Bilirubin oxidase; cleavage on PAIR of basic resid 95.9
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 95.86
3gyr_A612 PHS, phenoxazinone synthase; metalloprotein, lacca 95.86
1hfu_A503 Laccase 1; oxidoreductase, blue multi-copper oxida 95.82
1aoz_A552 Ascorbate oxidase; oxidoreductase(oxygen acceptor) 95.39
3t6v_A495 Laccase; beta barrel, oxidoreductase; HET: CBS; 2. 94.84
2yev_B 337 Cytochrome C oxidase subunit 2; electron transport 93.68
3pxl_A499 Laccase; 4-copper protein, metal-binding, oxidored 94.07
2uxt_A451 Protein SUFI, SUFI; oxidoreductase, periplasmic, c 94.01
3aw5_A448 Multicopper oxidase; beta barrel, oxidoreductase; 93.97
2q9o_A559 Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct 92.84
3sqr_A580 Laccase; multicopper oxidase, glycosylation, oxido 89.4
2wtp_A131 ORF131 protein, CZCE; metal binding protein, heavy 87.64
2x3c_A 343 Toxic extracellular endopeptidase; hydrolase; 1.99 81.51
2pq4_B35 Periplasmic nitrate reductase precursor; NAPD/NAPA 80.2
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
Probab=99.95  E-value=5.1e-28  Score=171.64  Aligned_cols=99  Identities=82%  Similarity=1.303  Sum_probs=85.9

Q ss_pred             EEEEEeecCCCceEeCCeEEEcCCCEEEEEeCCCCCeeEEEccCCCCCCccccccccccCccccCCCceEEEEeCCceeE
Q 030950           70 IEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTY  149 (168)
Q Consensus        70 ~~V~~~~~~g~~~F~P~~itV~~GdtV~f~N~d~~~Hnv~~~~~~~P~g~~~~~~~~~~~~~~i~pG~t~svtF~~pG~Y  149 (168)
                      ++|+|+++++++.|+|+.|+|++||+|+|+|.+..+|++++.+..+|++.+.+..++.+++..+.||++++++|++||+|
T Consensus         1 ~~v~m~~~~~~~~F~P~~i~v~~G~tV~~~n~~~~~H~v~~~~~~~p~~~~~~~~~~~~~~~~~~~G~~~~~tf~~~G~y   80 (99)
T 1plc_A            1 IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEY   80 (99)
T ss_dssp             CEEEESCTTCCSCEESSEEEECTTCEEEEEECSSCCBCCEECTTSSCTTCCHHHHCCCTTCCBCSTTCEEEEECCSCEEE
T ss_pred             CEEEEecCCCcceEeCCEEEECCCCEEEEEECCCCceEEEEeCCCCcccccccccccccCccccCCCCEEEEEECCCceE
Confidence            47889877788999999999999999999999988999999887677776543333334556789999999999999999


Q ss_pred             EEEcCCCCCCCcEEEEEeC
Q 030950          150 SFYCSPHQGAGMVGQVTVN  168 (168)
Q Consensus       150 ~y~C~~H~~~GM~G~I~V~  168 (168)
                      +|+|.+|+++||+|+|+|+
T Consensus        81 ~~~C~~H~~~gM~G~i~V~   99 (99)
T 1plc_A           81 SFYCSPHQGAGMVGKVTVN   99 (99)
T ss_dssp             EEECGGGTTTTCEEEEEEC
T ss_pred             EEEcCCCcccCCEEEEEEC
Confidence            9999999999999999996
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Back     alignment and structure
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>1cyx_A CYOA; electron transport; 2.30A {Escherichia coli} SCOP: b.6.1.2 PDB: 1cyw_A Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>3hb3_B Cytochrome C oxidase subunit 2; electron transfer, proton transfer, proton pumping, membrane protein, cell inner membrane, cell membrane, copper; HET: HEA LDA LMT; 2.25A {Paracoccus denitrificans} PDB: 1ar1_B* 3ehb_B* 1qle_B* Back     alignment and structure
>2gsm_B Cytochrome C oxidase subunit 2; transmembrane protein complex, oxidoreductase; HET: DMU HEA TRD; 2.00A {Rhodobacter sphaeroides} SCOP: b.6.1.2 f.17.2.1 PDB: 3dtu_B* 3fye_B* 3fyi_B* 3omi_B* 3om3_B* 3oma_B* 3omn_B* 1m56_B* 1m57_B* Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>1v54_B Cytochrome C oxidase polypeptide II; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: b.6.1.2 f.17.2.1 PDB: 1oco_B* 1occ_B* 1ocz_B* 1ocr_B* 1v55_B* 2dyr_B* 2dys_B* 2eij_B* 2eik_B* 2eil_B* 2eim_B* 2ein_B* 2occ_B* 2y69_B* 2ybb_M* 2zxw_B* 3abk_B* 3abl_B* 3abm_B* 3ag1_B* ... Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>1fft_B Ubiquinol oxidase; electron transport, cytochrome oxidase, membrane protein, oxidoreductase; HET: HEM HEO; 3.50A {Escherichia coli} SCOP: b.6.1.2 f.17.2.1 Back     alignment and structure
>2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Back     alignment and structure
>2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Back     alignment and structure
>2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Back     alignment and structure
>3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} Back     alignment and structure
>1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Back     alignment and structure
>1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Back     alignment and structure
>3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Back     alignment and structure
>2yev_B Cytochrome C oxidase subunit 2; electron transport; HET: FME 5PL HAS 4AG 7E8 HEC 7E9; 2.36A {Thermus thermophilus} Back     alignment and structure
>3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Back     alignment and structure
>2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Back     alignment and structure
>3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Back     alignment and structure
>2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Back     alignment and structure
>3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Back     alignment and structure
>2wtp_A ORF131 protein, CZCE; metal binding protein, heavy metal, copper binding; HET: TRS; 1.50A {Ralstonia metallidurans CH34} PDB: 2wto_A* Back     alignment and structure
>2x3c_A Toxic extracellular endopeptidase; hydrolase; 1.99A {Aeromonas salmonicida subsp} PDB: 2x3a_A 2x3b_A Back     alignment and structure
>2pq4_B Periplasmic nitrate reductase precursor; NAPD/NAPA1-35, mixed beta-alpha sandwich structure, protein- peptide complex, alpha-helix; NMR {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 168
d1plca_99 b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), 6e-34
d1bypa_99 b.6.1.1 (A:) Plastocyanin {White campion (Silene p 5e-30
d2q5ba1105 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Ph 1e-23
d2cj3a1105 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabili 1e-23
d1pcsa_98 b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synecho 6e-23
d1kdja_102 b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus 9e-23
d2plta_98 b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomon 2e-22
d1iuza_98 b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea let 1e-21
d2jxma197 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prok 1e-21
d1bxua_91 b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synecho 6e-20
d1bqka_124 b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclas 3e-19
d1paza_120 b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, s 8e-19
d1adwa_123 b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha 3e-18
d1pmya_123 b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorq 4e-17
d1id2a_106 b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiob 3e-16
d2ov0a1105 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrific 4e-14
d1jzga_128 b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId 2e-13
d1cuoa_129 b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32 2e-13
d1nwpa_128 b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 30 3e-12
d2ccwa1129 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans 7e-11
d1qhqa_139 b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus 1e-09
d1jera_110 b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativ 5e-06
d1ws8a_104 b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) 1e-05
d2j5wa2145 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sap 1e-04
d1e30a_153 b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidan 9e-04
d1sddb2139 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (B 0.004
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Length = 99 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Plastocyanin
species: Poplar (Populus nigra), variant italica [TaxId: 3691]

 Score =  113 bits (283), Expect = 6e-34
 Identities = 81/99 (81%), Positives = 87/99 (87%)

Query: 70  IEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTE 129
           I+VLLG DDGSLAFVPS FS+S GEKIVFKNNAGFPHN+VFDED IPSGVD SKISMS E
Sbjct: 1   IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEE 60

Query: 130 DLLNGPGETYAVTLTEKGTYSFYCSPHQGAGMVGQVTVN 168
           DLLN  GET+ V L+ KG YSFYCSPHQGAGMVG+VTVN
Sbjct: 61  DLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN 99
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Length = 99 Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Length = 105 Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Length = 105 Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Length = 98 Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Length = 102 Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 98 Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Length = 98 Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Length = 97 Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Length = 91 Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Length = 124 Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Length = 120 Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Length = 123 Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Length = 123 Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Length = 106 Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Length = 105 Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Length = 128 Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Length = 129 Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Length = 128 Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Length = 129 Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Length = 139 Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 110 Back     information, alignment and structure
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Length = 104 Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Length = 153 Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 139 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query168
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 99.96
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 99.94
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 99.94
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 99.94
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 99.94
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 99.94
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 99.93
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 99.93
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 99.93
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 99.92
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 99.92
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 99.91
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 99.9
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 99.9
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 99.9
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 99.88
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 99.77
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 99.73
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 99.73
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 99.71
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 99.67
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 99.64
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 99.53
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 99.49
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 99.45
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 99.4
d1jera_110 Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3 99.23
d1ws8a_104 Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663 99.21
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 98.9
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 98.89
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 98.87
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 98.87
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 98.86
d1f56a_91 Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 98.85
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 98.7
d2cbpa_96 Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3 98.7
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 98.7
d1kv7a1140 multi-copper oxidase CueO {Escherichia coli [TaxId 98.67
d1kcwa2146 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 98.53
d2j5wa2145 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 98.53
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 98.5
d1sddb2139 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 98.48
d1v10a1136 Laccase {Rigidoporus lignosus [TaxId: 219653]} 98.43
d2j5wa5149 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1kbva2151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 98.19
d1cyxa_158 Quinol oxidase (CyoA) {Escherichia coli [TaxId: 56 98.15
d2j5wa1192 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 98.09
d1sdda2116 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 98.05
d1sdda1180 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 98.05
d2bw4a2173 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 98.02
d2j5wa4179 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 97.87
d1oe1a2177 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 97.85
d2j5wa3207 Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} 97.83
d1gska3154 Spore coat protein A, CotA {Bacillus subtilis [Tax 97.5
d3ehbb1145 Cytochrome c oxidase {Paracoccus denitrificans [Ta 97.27
d1kv7a3181 multi-copper oxidase CueO {Escherichia coli [TaxId 97.24
d1gska1181 Spore coat protein A, CotA {Bacillus subtilis [Tax 97.17
d3dtub1152 Cytochrome c oxidase {Rhodobacter sphaeroides [Tax 97.13
d1v54b1137 Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 991 96.89
d1sddb167 Coagulation factor V {Cow (Bos taurus) [TaxId: 991 96.82
d1v10a3190 Laccase {Rigidoporus lignosus [TaxId: 219653]} 96.23
d1aoza3214 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 96.03
d1hfua3200 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 95.59
d1mzya2178 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 95.29
d1hfua2172 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 93.63
d1v10a2168 Laccase {Rigidoporus lignosus [TaxId: 219653]} 92.29
d1gyca3199 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 92.25
d1w8oa1103 Sialidase, "linker" domain {Micromonospora viridif 92.12
d1gyca2170 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 91.6
d2q9oa3216 Laccase {Melanocarpus albomyces [TaxId: 204285]} 91.34
d2q9oa2181 Laccase {Melanocarpus albomyces [TaxId: 204285]} 91.11
d1aoza2209 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 83.52
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Plastocyanin
species: Poplar (Populus nigra), variant italica [TaxId: 3691]

Probab=99.96  E-value=1.1e-29  Score=180.42  Aligned_cols=99  Identities=82%  Similarity=1.303  Sum_probs=86.4

Q ss_pred             EEEEEeecCCCceEeCCeEEEcCCCEEEEEeCCCCCeeEEEccCCCCCCccccccccccCccccCCCceEEEEeCCceeE
Q 030950           70 IEVLLGGDDGSLAFVPSSFSVSSGEKIVFKNNAGFPHNVVFDEDEIPSGVDVSKISMSTEDLLNGPGETYAVTLTEKGTY  149 (168)
Q Consensus        70 ~~V~~~~~~g~~~F~P~~itV~~GdtV~f~N~d~~~Hnv~~~~~~~P~g~~~~~~~~~~~~~~i~pG~t~svtF~~pG~Y  149 (168)
                      ++|+|+.++|+|+|+|+.|+|++||+|+|+|.+..+||+++++...|.+.+.....+.+.+....||++++++|++||+|
T Consensus         1 v~V~~g~d~g~~~F~P~~iti~~GdtV~f~n~~~~~Hnv~~~~~~~~~~~~~~~~~~~~~~~~~~~g~t~~~tF~~~G~y   80 (99)
T d1plca_           1 IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEY   80 (99)
T ss_dssp             CEEEESCTTCCSCEESSEEEECTTCEEEEEECSSCCBCCEECTTSSCTTCCHHHHCCCTTCCBCSTTCEEEEECCSCEEE
T ss_pred             CEEEEEeCCCceEEeCCEEEECCCCEEEEEECCCCCccEEEccCcCCCccccccCcccccccccCCCceEEEecCCCceE
Confidence            58999988889999999999999999999999988999999887767766544433445566778999999999999999


Q ss_pred             EEEcCCCCCCCcEEEEEeC
Q 030950          150 SFYCSPHQGAGMVGQVTVN  168 (168)
Q Consensus       150 ~y~C~~H~~~GM~G~I~V~  168 (168)
                      +|+|.+|+.+||+|+|+|+
T Consensus        81 ~Y~C~pH~~~GM~G~I~V~   99 (99)
T d1plca_          81 SFYCSPHQGAGMVGKVTVN   99 (99)
T ss_dssp             EEECGGGTTTTCEEEEEEC
T ss_pred             EEEeCCCcCCCcEEEEEEC
Confidence            9999999999999999995
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1cyxa_ b.6.1.2 (A:) Quinol oxidase (CyoA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3ehbb1 b.6.1.2 (B:108-252) Cytochrome c oxidase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3dtub1 b.6.1.2 (B:130-281) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1v54b1 b.6.1.2 (B:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1mzya2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure
>d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} Back     information, alignment and structure
>d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1w8oa1 b.1.18.2 (A:403-505) Sialidase, "linker" domain {Micromonospora viridifaciens [TaxId: 1881]} Back     information, alignment and structure
>d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure