Citrus Sinensis ID: 030957


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MQEQATSSIAASSLPSSSERSSSSALHLEVKEGMESDEEIRRVPEIGGEPGGTSASGRELVSTGGPDRVQQLGEGQRKRGRSPADKENKRLKRLLRNRVSAQQARERKKAYLNELETRVKDLERKNSELDERLSTLQNENQMLRHILKNTTASRRGGSGGDTNADGSF
ccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc
********************************************************************************************************RERKKAYLNELETRVKDLERKNSELDERLSTLQNENQMLR************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQEQATSSIAASSLPSSSERSSSSALHLEVKEGMESDEEIRRVPEIGGEPGGTSASGRELVSTGGPDRVQQLGEGQRKRGRSPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLKNTTASRRGGSGGDTNADGSF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor HY5 Transcription factor that promotes photomorphogenesis in the light. Acts downstream of the light receptor network and directly affects transcription of light-induced genes. Specifically involved in blue-light specific pathway, suggesting that it participates in transmission of cryptochromes (CRY1 and CRY2) signals to downstream responses. In darkness, its degradation prevent the activation of light-induced genes.confidentO24646
Transcription factor HY5 Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes.probableQ9SM50

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OQQ, chain A
Confidence level:very confident
Coverage over the Query: 109-149
View the alignment between query and template
View the model in PyMOL
Template: 1HJB, chain A
Confidence level:confident
Coverage over the Query: 84-149
View the alignment between query and template
View the model in PyMOL