Citrus Sinensis ID: 030957
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 168 | ||||||
| 255548962 | 169 | transcription factor hy5, putative [Rici | 0.994 | 0.988 | 0.864 | 1e-64 | |
| 224141881 | 168 | predicted protein [Populus trichocarpa] | 0.988 | 0.988 | 0.863 | 3e-64 | |
| 147844008 | 169 | hypothetical protein VITISV_024883 [Viti | 1.0 | 0.994 | 0.869 | 7e-64 | |
| 224089199 | 169 | predicted protein [Populus trichocarpa] | 0.988 | 0.982 | 0.846 | 1e-62 | |
| 427191153 | 164 | bZIP transcription factor [Malus x domes | 0.976 | 1.0 | 0.842 | 2e-58 | |
| 449441922 | 158 | PREDICTED: transcription factor HY5-like | 0.934 | 0.993 | 0.885 | 7e-58 | |
| 297811237 | 167 | hypothetical protein ARALYDRAFT_909087 [ | 0.988 | 0.994 | 0.781 | 1e-53 | |
| 18416509 | 168 | transcription factor HY5 [Arabidopsis th | 0.994 | 0.994 | 0.786 | 2e-51 | |
| 350537753 | 158 | transcription factor HY5 [Solanum lycope | 0.892 | 0.949 | 0.823 | 5e-51 | |
| 163954869 | 181 | DBtag [eukaryotic synthetic construct] | 0.994 | 0.922 | 0.786 | 6e-51 |
| >gi|255548962|ref|XP_002515537.1| transcription factor hy5, putative [Ricinus communis] gi|223545481|gb|EEF46986.1| transcription factor hy5, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 251 bits (640), Expect = 1e-64, Method: Compositional matrix adjust.
Identities = 147/170 (86%), Positives = 153/170 (90%), Gaps = 3/170 (1%)
Query: 1 MQEQATSSIAASSLPSSSERSSSSALHLEVKEGMESDEEIRRVPEIGGEPGGTSASGREL 60
MQEQA+SSIAA+SLPSSSERSSSSAL LEVKEGMESDEEIRRVPE GGE GTSASGR+
Sbjct: 1 MQEQASSSIAANSLPSSSERSSSSALQLEVKEGMESDEEIRRVPEFGGEQAGTSASGRDA 60
Query: 61 VSTGGPDRVQQLGEGQ--RKRGRSPADKENKRLKRLLRNRVSAQQARERKKAYLNELETR 118
S G DRVQ GEGQ RKRGRSPADKENKRLKRLLRNRVSAQQARERKKAYLNELETR
Sbjct: 61 SSVAGRDRVQAPGEGQTPRKRGRSPADKENKRLKRLLRNRVSAQQARERKKAYLNELETR 120
Query: 119 VKDLERKNSELDERLSTLQNENQMLRHILKNTTASRRGGSGGDTNADGSF 168
VKDLE+KNSEL+ERLSTLQNENQMLRHILKNTTASRRGGS +TN DGS
Sbjct: 121 VKDLEKKNSELEERLSTLQNENQMLRHILKNTTASRRGGS-SNTNGDGSL 169
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224141881|ref|XP_002324289.1| predicted protein [Populus trichocarpa] gi|222865723|gb|EEF02854.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147844008|emb|CAN83322.1| hypothetical protein VITISV_024883 [Vitis vinifera] gi|296082014|emb|CBI21019.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224089199|ref|XP_002308656.1| predicted protein [Populus trichocarpa] gi|222854632|gb|EEE92179.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|427191153|dbj|BAM71071.1| bZIP transcription factor [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|449441922|ref|XP_004138731.1| PREDICTED: transcription factor HY5-like [Cucumis sativus] gi|323099915|gb|ADX23549.1| bZIP2 [Cucumis melo] | Back alignment and taxonomy information |
|---|
| >gi|297811237|ref|XP_002873502.1| hypothetical protein ARALYDRAFT_909087 [Arabidopsis lyrata subsp. lyrata] gi|297319339|gb|EFH49761.1| hypothetical protein ARALYDRAFT_909087 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18416509|ref|NP_568246.1| transcription factor HY5 [Arabidopsis thaliana] gi|20138463|sp|O24646.1|HY5_ARATH RecName: Full=Transcription factor HY5; AltName: Full=Protein LONG HYPOCOTYL 5; AltName: Full=bZIP transcription factor 56; Short=AtbZIP56 gi|2244709|dbj|BAA21116.1| HY5 [Arabidopsis thaliana] gi|2251085|dbj|BAA21327.1| HY5 [Arabidopsis thaliana] gi|8953388|emb|CAB96661.1| HY5 [Arabidopsis thaliana] gi|98960907|gb|ABF58937.1| At5g11260 [Arabidopsis thaliana] gi|110738599|dbj|BAF01225.1| bZip transcription factor HY5 / AtbZip56 [Arabidopsis thaliana] gi|332004270|gb|AED91653.1| transcription factor HY5 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|350537753|ref|NP_001234820.1| transcription factor HY5 [Solanum lycopersicum] gi|55976204|sp|Q9SM50.1|HY5_SOLLC RecName: Full=Transcription factor HY5; AltName: Full=LeHY5; AltName: Full=tHY5 gi|6018699|emb|CAB57979.1| THY5 protein [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
| >gi|163954869|dbj|BAF96503.1| DBtag [eukaryotic synthetic construct] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 168 | ||||||
| TAIR|locus:2148007 | 168 | HY5 "ELONGATED HYPOCOTYL 5" [A | 0.988 | 0.988 | 0.613 | 2.3e-46 | |
| TAIR|locus:1005716533 | 149 | HYH "AT3G17609" [Arabidopsis t | 0.690 | 0.778 | 0.445 | 1.9e-19 | |
| UNIPROTKB|A2VD01 | 525 | creb3l2 "Cyclic AMP-responsive | 0.345 | 0.110 | 0.362 | 5.6e-06 | |
| UNIPROTKB|F1P1J2 | 488 | CREB3L2 "Uncharacterized prote | 0.345 | 0.118 | 0.344 | 5.9e-06 | |
| DICTYBASE|DDB_G0279529 | 631 | bzpF "putative basic-leucine z | 0.398 | 0.106 | 0.381 | 3.8e-05 | |
| UNIPROTKB|F1NAC0 | 262 | XBP1 "Uncharacterized protein" | 0.541 | 0.347 | 0.343 | 4.2e-05 | |
| RGD|1303073 | 267 | Xbp1 "X-box binding protein 1" | 0.529 | 0.333 | 0.355 | 4.4e-05 | |
| UNIPROTKB|Q3SZZ2 | 261 | XBP1 "X-box-binding protein 1" | 0.583 | 0.375 | 0.353 | 5.4e-05 | |
| MGI|MGI:98970 | 267 | Xbp1 "X-box binding protein 1" | 0.529 | 0.333 | 0.355 | 5.7e-05 | |
| UNIPROTKB|F1PET1 | 381 | XBP1 "Uncharacterized protein" | 0.648 | 0.286 | 0.330 | 8.3e-05 |
| TAIR|locus:2148007 HY5 "ELONGATED HYPOCOTYL 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 486 (176.1 bits), Expect = 2.3e-46, P = 2.3e-46
Identities = 103/168 (61%), Positives = 114/168 (67%)
Query: 1 MQEQXXXXXXXXXXXXXXXXXXXXXLHLEVKEGMESDEEIRRVPEIGGEPGGTSASGREL 60
MQEQ HLE+KEG+ESDEEIRRVPE GGE G SGRE
Sbjct: 1 MQEQATSSLAASSLPSSSERSSSSAPHLEIKEGIESDEEIRRVPEFGGEAVGKETSGRES 60
Query: 61 VSTGGPDRVQQ-LGEGQRKRGRSPADKEXXXXXXXXXXXVSAQQARERKKAYLNELETRV 119
S G +R Q +GE QRKRGR+PA+KE VSAQQARERKKAYL+ELE RV
Sbjct: 61 GSATGQERTQATVGESQRKRGRTPAEKENKRLKRLLRNRVSAQQARERKKAYLSELENRV 120
Query: 120 KDLERKNSELDERLSTLQNENQMLRHILKNTTASRRGGSGGDTNADGS 167
KDLE KNSEL+ERLSTLQNENQMLRHILKNTT ++RGG GG +NAD S
Sbjct: 121 KDLENKNSELEERLSTLQNENQMLRHILKNTTGNKRGGGGG-SNADAS 167
|
|
| TAIR|locus:1005716533 HYH "AT3G17609" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A2VD01 creb3l2 "Cyclic AMP-responsive element-binding protein 3-like protein 2" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P1J2 CREB3L2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0279529 bzpF "putative basic-leucine zipper (bZIP) transcription factor" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NAC0 XBP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1303073 Xbp1 "X-box binding protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3SZZ2 XBP1 "X-box-binding protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:98970 Xbp1 "X-box binding protein 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PET1 XBP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pm.C_LG_XVIII000127 | hypothetical protein (168 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 168 | |||
| smart00338 | 65 | smart00338, BRLZ, basic region leucin zipper | 1e-10 | |
| pfam00170 | 64 | pfam00170, bZIP_1, bZIP transcription factor | 4e-08 | |
| pfam07716 | 54 | pfam07716, bZIP_2, Basic region leucine zipper | 4e-06 | |
| cd12193 | 54 | cd12193, B_zip1, basic leucine zipper DNA-binding | 5e-04 |
| >gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper | Back alignment and domain information |
|---|
Score = 54.1 bits (131), Expect = 1e-10
Identities = 25/63 (39%), Positives = 42/63 (66%)
Query: 86 KENKRLKRLLRNRVSAQQARERKKAYLNELETRVKDLERKNSELDERLSTLQNENQMLRH 145
++ KR +R RNR +A+++RERKKA + ELE +V+ LE +N L + + L+ E + L+
Sbjct: 2 EDEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKS 61
Query: 146 ILK 148
L+
Sbjct: 62 ELE 64
|
Length = 65 |
| >gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor | Back alignment and domain information |
|---|
| >gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper | Back alignment and domain information |
|---|
| >gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 168 | |||
| smart00338 | 65 | BRLZ basic region leucin zipper. | 99.64 | |
| PF00170 | 64 | bZIP_1: bZIP transcription factor cAMP response el | 99.56 | |
| PF07716 | 54 | bZIP_2: Basic region leucine zipper; InterPro: IPR | 99.36 | |
| KOG4005 | 292 | consensus Transcription factor XBP-1 [Transcriptio | 99.33 | |
| KOG3584 | 348 | consensus cAMP response element binding protein an | 99.31 | |
| KOG0709 | 472 | consensus CREB/ATF family transcription factor [Tr | 99.27 | |
| KOG4571 | 294 | consensus Activating transcription factor 4 [Trans | 99.26 | |
| KOG4343 | 655 | consensus bZIP transcription factor ATF6 [Transcri | 99.03 | |
| KOG3119 | 269 | consensus Basic region leucine zipper transcriptio | 98.91 | |
| KOG0837 | 279 | consensus Transcriptional activator of the JUN fam | 98.62 | |
| PF03131 | 92 | bZIP_Maf: bZIP Maf transcription factor; InterPro: | 98.49 | |
| KOG3863 | 604 | consensus bZIP transcription factor NRF1 [Transcri | 98.0 | |
| KOG4196 | 135 | consensus bZIP transcription factor MafK [Transcri | 97.88 | |
| KOG1414 | 395 | consensus Transcriptional activator FOSB/c-Fos and | 97.76 | |
| KOG1414 | 395 | consensus Transcriptional activator FOSB/c-Fos and | 96.71 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 95.08 | |
| PRK00736 | 68 | hypothetical protein; Provisional | 95.02 | |
| PF08172 | 248 | CASP_C: CASP C terminal; InterPro: IPR012955 This | 94.94 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 94.77 | |
| TIGR02449 | 65 | conserved hypothetical protein TIGR02449. Members | 94.74 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 94.73 | |
| PRK00295 | 68 | hypothetical protein; Provisional | 94.72 | |
| PRK04325 | 74 | hypothetical protein; Provisional | 94.72 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 94.65 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 94.65 | |
| PRK02793 | 72 | phi X174 lysis protein; Provisional | 94.39 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 93.63 | |
| PRK00846 | 77 | hypothetical protein; Provisional | 93.2 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 93.06 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 93.06 | |
| PF10226 | 195 | DUF2216: Uncharacterized conserved proteins (DUF22 | 92.97 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 92.88 | |
| PRK13922 | 276 | rod shape-determining protein MreC; Provisional | 92.62 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 92.54 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 92.41 | |
| PF01166 | 59 | TSC22: TSC-22/dip/bun family; InterPro: IPR000580 | 92.4 | |
| PF15058 | 200 | Speriolin_N: Speriolin N terminus | 91.93 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 91.46 | |
| PF10224 | 80 | DUF2205: Predicted coiled-coil protein (DUF2205); | 91.3 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 91.27 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 91.19 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 91.16 | |
| PF12709 | 87 | Kinetocho_Slk19: Central kinetochore-associated; I | 90.94 | |
| PRK00888 | 105 | ftsB cell division protein FtsB; Reviewed | 90.93 | |
| PF05377 | 55 | FlaC_arch: Flagella accessory protein C (FlaC); In | 90.87 | |
| TIGR00219 | 283 | mreC rod shape-determining protein MreC. MreC (mur | 90.69 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 90.58 | |
| KOG4343 | 655 | consensus bZIP transcription factor ATF6 [Transcri | 90.31 | |
| PRK13729 | 475 | conjugal transfer pilus assembly protein TraB; Pro | 89.94 | |
| PF12808 | 52 | Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 | 89.88 | |
| KOG3119 | 269 | consensus Basic region leucine zipper transcriptio | 89.73 | |
| PF11365 | 96 | DUF3166: Protein of unknown function (DUF3166); In | 89.36 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 89.31 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 88.85 | |
| PRK09413 | 121 | IS2 repressor TnpA; Reviewed | 88.7 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 88.18 | |
| PF04880 | 166 | NUDE_C: NUDE protein, C-terminal conserved region; | 88.15 | |
| PF04977 | 80 | DivIC: Septum formation initiator; InterPro: IPR00 | 88.03 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 87.87 | |
| PF03670 | 83 | UPF0184: Uncharacterised protein family (UPF0184); | 87.8 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 87.72 | |
| PF05377 | 55 | FlaC_arch: Flagella accessory protein C (FlaC); In | 87.68 | |
| PRK14127 | 109 | cell division protein GpsB; Provisional | 87.59 | |
| PRK00888 | 105 | ftsB cell division protein FtsB; Reviewed | 87.57 | |
| PF09744 | 158 | Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte | 87.56 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 87.3 | |
| KOG3335 | 181 | consensus Predicted coiled-coil protein [General f | 87.28 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 87.08 | |
| PF03980 | 109 | Nnf1: Nnf1 ; InterPro: IPR007128 NNF1 is an essent | 87.04 | |
| PRK00736 | 68 | hypothetical protein; Provisional | 86.84 | |
| PF10226 | 195 | DUF2216: Uncharacterized conserved proteins (DUF22 | 86.74 | |
| PF06216 | 389 | RTBV_P46: Rice tungro bacilliform virus P46 protei | 86.66 | |
| TIGR02449 | 65 | conserved hypothetical protein TIGR02449. Members | 86.57 | |
| PF00170 | 64 | bZIP_1: bZIP transcription factor cAMP response el | 86.57 | |
| PRK04325 | 74 | hypothetical protein; Provisional | 86.51 | |
| PF14775 | 60 | NYD-SP28_assoc: Sperm tail C-terminal domain | 86.36 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 86.22 | |
| PRK02793 | 72 | phi X174 lysis protein; Provisional | 85.97 | |
| PF11500 | 152 | Cut12: Spindle pole body formation-associated prot | 85.9 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 85.76 | |
| KOG4196 | 135 | consensus bZIP transcription factor MafK [Transcri | 85.74 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 85.66 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 85.51 | |
| PF05103 | 131 | DivIVA: DivIVA protein; InterPro: IPR007793 The Ba | 85.43 | |
| COG2900 | 72 | SlyX Uncharacterized protein conserved in bacteria | 85.39 | |
| PF04977 | 80 | DivIC: Septum formation initiator; InterPro: IPR00 | 85.17 | |
| PRK00295 | 68 | hypothetical protein; Provisional | 85.01 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 84.86 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 84.74 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 84.52 | |
| COG4467 | 114 | Regulator of replication initiation timing [Replic | 84.48 | |
| PF08232 | 134 | Striatin: Striatin family; InterPro: IPR013258 Thi | 83.96 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 83.8 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 83.68 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 83.44 | |
| PF12709 | 87 | Kinetocho_Slk19: Central kinetochore-associated; I | 83.44 | |
| PRK11637 | 428 | AmiB activator; Provisional | 83.4 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 83.23 | |
| PF01166 | 59 | TSC22: TSC-22/dip/bun family; InterPro: IPR000580 | 83.15 | |
| PF11365 | 96 | DUF3166: Protein of unknown function (DUF3166); In | 82.97 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 82.92 | |
| PRK11637 | 428 | AmiB activator; Provisional | 82.56 | |
| PF05812 | 118 | Herpes_BLRF2: Herpesvirus BLRF2 protein; InterPro: | 82.32 | |
| PF15556 | 252 | Zwint: ZW10 interactor | 82.28 | |
| cd00632 | 105 | Prefoldin_beta Prefoldin beta; Prefoldin is a hexa | 82.26 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 81.4 | |
| PF07334 | 76 | IFP_35_N: Interferon-induced 35 kDa protein (IFP 3 | 81.2 | |
| PF01920 | 106 | Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 | 81.16 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 81.16 | |
| PF05700 | 221 | BCAS2: Breast carcinoma amplified sequence 2 (BCAS | 81.14 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 80.9 | |
| PRK00846 | 77 | hypothetical protein; Provisional | 80.82 | |
| PF04899 | 70 | MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 Th | 80.74 | |
| TIGR02209 | 85 | ftsL_broad cell division protein FtsL. This model | 80.69 | |
| PF07989 | 75 | Microtub_assoc: Microtubule associated; InterPro: | 80.68 | |
| smart00338 | 65 | BRLZ basic region leucin zipper. | 80.59 |
| >smart00338 BRLZ basic region leucin zipper | Back alignment and domain information |
|---|
Probab=99.64 E-value=2.1e-15 Score=102.76 Aligned_cols=63 Identities=40% Similarity=0.588 Sum_probs=60.2
Q ss_pred HHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 030957 86 KENKRLKRLLRNRVSAQQARERKKAYLNELETRVKDLERKNSELDERLSTLQNENQMLRHILK 148 (168)
Q Consensus 86 ~e~kr~rR~~rNR~AA~~sR~RKk~~~~~LE~~v~~Le~eN~~L~~~v~~L~~En~~Lr~~L~ 148 (168)
+++++.+|+++||+||++||+||+.|+.+||.++..|+.+|..|..+|..|..|+..|++++.
T Consensus 2 ~~~k~~rR~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~~~l~~e~~~lk~~~~ 64 (65)
T smart00338 2 EDEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSELE 64 (65)
T ss_pred ccHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence 457889999999999999999999999999999999999999999999999999999999874
|
|
| >PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization | Back alignment and domain information |
|---|
| >PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization | Back alignment and domain information |
|---|
| >KOG4005 consensus Transcription factor XBP-1 [Transcription] | Back alignment and domain information |
|---|
| >KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >KOG0709 consensus CREB/ATF family transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG4571 consensus Activating transcription factor 4 [Transcription] | Back alignment and domain information |
|---|
| >KOG4343 consensus bZIP transcription factor ATF6 [Transcription] | Back alignment and domain information |
|---|
| >KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0837 consensus Transcriptional activator of the JUN family [Transcription] | Back alignment and domain information |
|---|
| >PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell | Back alignment and domain information |
|---|
| >KOG3863 consensus bZIP transcription factor NRF1 [Transcription] | Back alignment and domain information |
|---|
| >KOG4196 consensus bZIP transcription factor MafK [Transcription] | Back alignment and domain information |
|---|
| >KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] | Back alignment and domain information |
|---|
| >KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >PRK00736 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >TIGR02449 conserved hypothetical protein TIGR02449 | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >PRK00295 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04325 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02793 phi X174 lysis protein; Provisional | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PRK00846 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PRK13922 rod shape-determining protein MreC; Provisional | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation | Back alignment and domain information |
|---|
| >PF15058 Speriolin_N: Speriolin N terminus | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore | Back alignment and domain information |
|---|
| >PRK00888 ftsB cell division protein FtsB; Reviewed | Back alignment and domain information |
|---|
| >PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] | Back alignment and domain information |
|---|
| >TIGR00219 mreC rod shape-determining protein MreC | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >KOG4343 consensus bZIP transcription factor ATF6 [Transcription] | Back alignment and domain information |
|---|
| >PRK13729 conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi | Back alignment and domain information |
|---|
| >KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PF11365 DUF3166: Protein of unknown function (DUF3166); InterPro: IPR021507 This eukaryotic family of proteins has no known function | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PRK09413 IS2 repressor TnpA; Reviewed | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins | Back alignment and domain information |
|---|
| >PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF03670 UPF0184: Uncharacterised protein family (UPF0184); InterPro: IPR022788 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] | Back alignment and domain information |
|---|
| >PRK14127 cell division protein GpsB; Provisional | Back alignment and domain information |
|---|
| >PRK00888 ftsB cell division protein FtsB; Reviewed | Back alignment and domain information |
|---|
| >PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >KOG3335 consensus Predicted coiled-coil protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03980 Nnf1: Nnf1 ; InterPro: IPR007128 NNF1 is an essential yeast gene required for proper spindle orientation, nucleolar and nuclear envelope structure and mRNA export [] | Back alignment and domain information |
|---|
| >PRK00736 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain | Back alignment and domain information |
|---|
| >PF06216 RTBV_P46: Rice tungro bacilliform virus P46 protein; InterPro: IPR009347 This family consists of several Rice tungro bacilliform virus P46 proteins | Back alignment and domain information |
|---|
| >TIGR02449 conserved hypothetical protein TIGR02449 | Back alignment and domain information |
|---|
| >PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization | Back alignment and domain information |
|---|
| >PRK04325 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14775 NYD-SP28_assoc: Sperm tail C-terminal domain | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PRK02793 phi X174 lysis protein; Provisional | Back alignment and domain information |
|---|
| >PF11500 Cut12: Spindle pole body formation-associated protein; InterPro: IPR021589 This is the central coiled-coil region of cut12 also found in other fungi, barring S | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4196 consensus bZIP transcription factor MafK [Transcription] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] | Back alignment and domain information |
|---|
| >COG2900 SlyX Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] | Back alignment and domain information |
|---|
| >PRK00295 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF08232 Striatin: Striatin family; InterPro: IPR013258 This domain is associated with the N terminus of striatin | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation | Back alignment and domain information |
|---|
| >PF11365 DUF3166: Protein of unknown function (DUF3166); InterPro: IPR021507 This eukaryotic family of proteins has no known function | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF05812 Herpes_BLRF2: Herpesvirus BLRF2 protein; InterPro: IPR008642 This family consists of several herpes virus BLRF2 tegument proteins | Back alignment and domain information |
|---|
| >PF15556 Zwint: ZW10 interactor | Back alignment and domain information |
|---|
| >cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF07334 IFP_35_N: Interferon-induced 35 kDa protein (IFP 35) N-terminus; InterPro: IPR009938 This entry represents the N terminus of interferon-induced 35 kDa protein (IFP 35) (approximately 80 residues long), which contains a leucine zipper motif in an alpha helical configuration [] | Back alignment and domain information |
|---|
| >PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK00846 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04899 MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 The MbeD and MobD proteins are plasmid encoded, and are involved in the plasmid mobilisation and transfer in the presence of conjugative plasmids [] | Back alignment and domain information |
|---|
| >TIGR02209 ftsL_broad cell division protein FtsL | Back alignment and domain information |
|---|
| >PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] | Back alignment and domain information |
|---|
| >smart00338 BRLZ basic region leucin zipper | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 168 | ||||
| 2oqq_A | 42 | Crystal Structure Of Hy5 Leucine Zipper Homodimer F | 5e-14 |
| >pdb|2OQQ|A Chain A, Crystal Structure Of Hy5 Leucine Zipper Homodimer From Arabidopsis Thaliana Length = 42 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 168 | |||
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 5e-15 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 5e-12 | |
| 2oqq_A | 42 | Transcription factor HY5; homodimer leucine zipper | 1e-11 | |
| 1dh3_A | 55 | Transcription factor CREB; protein-DNA complex, tr | 6e-11 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 1e-10 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 5e-10 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 4e-09 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 2e-07 | |
| 3a5t_A | 107 | Transcription factor MAFG; protein-DNA complex, BZ | 7e-06 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 2e-05 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 2e-04 | |
| 2dgc_A | 63 | Protein (GCN4); basic domain, leucine zipper, DNA | 4e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 6e-04 |
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 | Back alignment and structure |
|---|
Score = 64.7 bits (158), Expect = 5e-15
Identities = 21/59 (35%), Positives = 37/59 (62%)
Query: 89 KRLKRLLRNRVSAQQARERKKAYLNELETRVKDLERKNSELDERLSTLQNENQMLRHIL 147
KR K L RNR +A ++R+++K ++ LE + +DL N +L ++ L+NE L+ +L
Sbjct: 1 KRRKFLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLL 59
|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 | Back alignment and structure |
|---|
| >2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Length = 42 | Back alignment and structure |
|---|
| >1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 | Back alignment and structure |
|---|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 | Back alignment and structure |
|---|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 | Back alignment and structure |
|---|
| >3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 | Back alignment and structure |
|---|
| >2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 168 | |||
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 99.67 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 99.66 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 99.62 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 99.61 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 99.51 | |
| 1dh3_A | 55 | Transcription factor CREB; protein-DNA complex, tr | 99.5 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 99.45 | |
| 2dgc_A | 63 | Protein (GCN4); basic domain, leucine zipper, DNA | 99.36 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 99.17 | |
| 2oqq_A | 42 | Transcription factor HY5; homodimer leucine zipper | 99.04 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 98.76 | |
| 3a5t_A | 107 | Transcription factor MAFG; protein-DNA complex, BZ | 98.62 | |
| 1skn_P | 92 | DNA-binding domain of SKN-1; complex (transcriptio | 97.48 | |
| 2c9l_Y | 63 | EB1, zebra, BZLF1 trans-activator protein; viral p | 96.55 | |
| 2oxj_A | 34 | Hybrid alpha/beta peptide based on the GCN4-P1 Se | 96.23 | |
| 1kd8_A | 36 | GABH AIV, GCN4 acid base heterodimer acid-D12IA16V | 96.17 | |
| 3m48_A | 33 | General control protein GCN4; leucine zipper, synt | 96.06 | |
| 1kd8_B | 36 | GABH BLL, GCN4 acid base heterodimer base-D12LA16L | 95.97 | |
| 3c3f_A | 34 | Alpha/beta peptide with the GCN4-PLI SIDE chain S | 95.85 | |
| 2bni_A | 34 | General control protein GCN4; four helix bundle, a | 95.52 | |
| 3c3g_A | 33 | Alpha/beta peptide with the GCN4-PLI SIDE chain S | 95.43 | |
| 2kz5_A | 91 | Transcription factor NF-E2 45 kDa subunit; structu | 95.31 | |
| 2hy6_A | 34 | General control protein GCN4; protein design, para | 95.29 | |
| 2yy0_A | 53 | C-MYC-binding protein; conserved hypothetical prot | 95.19 | |
| 1uo4_A | 34 | General control protein GCN4; four helix bundle, c | 95.13 | |
| 2wq1_A | 33 | General control protein GCN4; TAA, nucleus, coiled | 95.12 | |
| 3he5_A | 49 | Synzip1; heterodimeric coiled-coil, de novo protei | 94.75 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 94.47 | |
| 2r2v_A | 34 | GCN4 leucine zipper; coiled coils, anti-parallel t | 94.33 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 94.14 | |
| 3efg_A | 78 | Protein SLYX homolog; xanthomonas campestris PV. c | 94.08 | |
| 3m91_A | 51 | Proteasome-associated ATPase; coil COIL alpha heli | 93.84 | |
| 1fmh_A | 33 | General control protein GCN4; coiled coil, leucine | 93.55 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 93.04 | |
| 1deb_A | 54 | APC protein, adenomatous polyposis coli protein; c | 93.03 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 91.95 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 91.93 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 91.87 | |
| 3ra3_B | 28 | P2F; coiled coil domain, fiber, KIH interactions, | 91.71 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 91.51 | |
| 3m9b_A | 251 | Proteasome-associated ATPase; coil COIL with 5 bet | 91.13 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 90.92 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 90.75 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 90.53 | |
| 1a93_B | 34 | MAX protein, coiled coil, LZ; leucine zipper, 2D s | 90.52 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 90.11 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 89.68 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 89.56 | |
| 1gmj_A | 84 | ATPase inhibitor; coiled-coil structure, P depende | 89.51 | |
| 1kd8_B | 36 | GABH BLL, GCN4 acid base heterodimer base-D12LA16L | 88.85 | |
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 88.84 | |
| 2w6a_A | 63 | ARF GTPase-activating protein GIT1; PIX, zinc, sig | 88.73 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 88.56 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 88.56 | |
| 1dip_A | 78 | Delta-sleep-inducing peptide immunoreactive peptid | 88.37 | |
| 1uii_A | 83 | Geminin; human, DNA replication, cell cycle; 2.00A | 88.28 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 88.11 | |
| 1p9i_A | 31 | Cortexillin I/GCN4 hybrid peptide; coiled-coil, un | 88.05 | |
| 2xdj_A | 83 | Uncharacterized protein YBGF; unknown function; 1. | 87.78 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 87.51 | |
| 2oxj_A | 34 | Hybrid alpha/beta peptide based on the GCN4-P1 Se | 87.11 | |
| 4dzn_A | 33 | Coiled-coil peptide CC-PIL; de novo protein; HET: | 87.05 | |
| 3m48_A | 33 | General control protein GCN4; leucine zipper, synt | 86.98 | |
| 1kd8_A | 36 | GABH AIV, GCN4 acid base heterodimer acid-D12IA16V | 86.92 | |
| 2lz1_A | 90 | Nuclear factor erythroid 2-related factor 2; struc | 86.89 | |
| 2wq1_A | 33 | General control protein GCN4; TAA, nucleus, coiled | 86.51 | |
| 2wuj_A | 57 | Septum site-determining protein diviva; bacterial | 86.16 | |
| 1wlq_A | 83 | Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2z | 85.79 | |
| 3c3f_A | 34 | Alpha/beta peptide with the GCN4-PLI SIDE chain S | 85.65 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 85.47 | |
| 2dgc_A | 63 | Protein (GCN4); basic domain, leucine zipper, DNA | 85.23 | |
| 2zxx_A | 79 | Geminin; coiled-coil, cell cycle, coiled coil, DNA | 85.23 | |
| 1dh3_A | 55 | Transcription factor CREB; protein-DNA complex, tr | 85.09 | |
| 2wvr_A | 209 | Geminin; DNA replication license, DNA replication | 84.42 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 84.28 | |
| 3c3g_A | 33 | Alpha/beta peptide with the GCN4-PLI SIDE chain S | 84.27 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 84.16 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 84.06 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 83.85 | |
| 1dip_A | 78 | Delta-sleep-inducing peptide immunoreactive peptid | 83.75 | |
| 2oqq_A | 42 | Transcription factor HY5; homodimer leucine zipper | 83.73 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 83.64 | |
| 1fxk_A | 107 | Prefoldin; archaeal protein, chaperone; 2.30A {Met | 83.57 | |
| 1uo4_A | 34 | General control protein GCN4; four helix bundle, c | 83.5 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 83.45 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 83.35 | |
| 1wt6_A | 81 | Myotonin-protein kinase; coiled-coil, kinase activ | 83.31 | |
| 2xdj_A | 83 | Uncharacterized protein YBGF; unknown function; 1. | 83.09 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 82.96 | |
| 1a93_B | 34 | MAX protein, coiled coil, LZ; leucine zipper, 2D s | 82.89 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 82.52 | |
| 3qh9_A | 81 | Liprin-beta-2; coiled-coil, dimerization, structur | 82.25 | |
| 3s9g_A | 104 | Protein hexim1; cyclin T-binding domain (TBD), cyc | 82.06 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 82.06 | |
| 1deb_A | 54 | APC protein, adenomatous polyposis coli protein; c | 82.02 | |
| 2j5u_A | 255 | MREC protein; bacterial cell shape determining pro | 81.94 | |
| 3swy_A | 46 | Cyclic nucleotide-gated cation channel alpha-3; co | 81.87 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 81.84 | |
| 2bni_A | 34 | General control protein GCN4; four helix bundle, a | 81.72 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 81.71 | |
| 2hy6_A | 34 | General control protein GCN4; protein design, para | 81.61 | |
| 3w03_C | 184 | DNA repair protein XRCC4; coiled-coil, NHEJ, DSBS | 81.59 | |
| 1zme_C | 70 | Proline utilization transcription activator; compl | 81.09 | |
| 2yy0_A | 53 | C-MYC-binding protein; conserved hypothetical prot | 81.01 | |
| 1uii_A | 83 | Geminin; human, DNA replication, cell cycle; 2.00A | 80.81 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 80.59 | |
| 3s9g_A | 104 | Protein hexim1; cyclin T-binding domain (TBD), cyc | 80.34 | |
| 2oa5_A | 110 | Hypothetical protein BQLF2; MHR28B, NESG, structur | 80.01 |
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
Probab=99.67 E-value=3.1e-16 Score=105.24 Aligned_cols=59 Identities=36% Similarity=0.590 Sum_probs=57.1
Q ss_pred HHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 030957 89 KRLKRLLRNRVSAQQARERKKAYLNELETRVKDLERKNSELDERLSTLQNENQMLRHIL 147 (168)
Q Consensus 89 kr~rR~~rNR~AA~~sR~RKk~~~~~LE~~v~~Le~eN~~L~~~v~~L~~En~~Lr~~L 147 (168)
|+.+|+++||+||++||+||++|+.+||.++..|+.+|..|..+|..|..|+..|+++|
T Consensus 1 kR~~r~erNr~AA~k~R~rKk~~~~~Le~~~~~L~~~n~~L~~~i~~L~~e~~~Lk~~l 59 (61)
T 1t2k_D 1 KRRKFLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLL 59 (61)
T ss_dssp CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred CHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence 46789999999999999999999999999999999999999999999999999999987
|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A | Back alignment and structure |
|---|
| >2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A | Back alignment and structure |
|---|
| >3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 | Back alignment and structure |
|---|
| >2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y | Back alignment and structure |
|---|
| >2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* | Back alignment and structure |
|---|
| >1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A | Back alignment and structure |
|---|
| >3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A | Back alignment and structure |
|---|
| >1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B | Back alignment and structure |
|---|
| >3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... | Back alignment and structure |
|---|
| >3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* | Back alignment and structure |
|---|
| >2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A | Back alignment and structure |
|---|
| >2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* | Back alignment and structure |
|---|
| >2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... | Back alignment and structure |
|---|
| >3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2r2v_A GCN4 leucine zipper; coiled coils, anti-parallel tetramer, protein design, de novo protein; HET: CIT; 1.90A {Saccharomyces cerevisiae} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A | Back alignment and structure |
|---|
| >1fmh_A General control protein GCN4; coiled coil, leucine zipper, inter-helical ION pairing, transcription; NMR {Synthetic} SCOP: k.6.1.1 PDB: 1u2u_A | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >3ra3_B P2F; coiled coil domain, fiber, KIH interactions, synthetic biolo helical reconstruction, de novo protein; HET: PHI; 2.31A {Synthetic} | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >1a93_B MAX protein, coiled coil, LZ; leucine zipper, 2D solution structure, H-bonds, buried salt bridge, proto-oncogene, nuclear protein; NMR {Mus musculus} SCOP: h.1.3.1 PDB: 2a93_B | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >1gmj_A ATPase inhibitor; coiled-coil structure, P dependent oligomerization, ATP hydrolysis; 2.2A {Bos taurus} SCOP: h.4.8.1 PDB: 1ohh_H* 1hf9_A | Back alignment and structure |
|---|
| >1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B | Back alignment and structure |
|---|
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C | Back alignment and structure |
|---|
| >2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >1dip_A Delta-sleep-inducing peptide immunoreactive peptide; structure, leucine zipper, PIG, acetylation; NMR {Sus scrofa} SCOP: h.1.12.1 | Back alignment and structure |
|---|
| >1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} SCOP: h.1.28.1 | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >1p9i_A Cortexillin I/GCN4 hybrid peptide; coiled-coil, unknown function; 1.17A {Synthetic} SCOP: h.1.10.1 | Back alignment and structure |
|---|
| >2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* | Back alignment and structure |
|---|
| >4dzn_A Coiled-coil peptide CC-PIL; de novo protein; HET: PHI; 1.59A {Synthetic} PDB: 4dzm_A* 4dzl_A* 4dzk_A 1u0i_A 1u0i_B | Back alignment and structure |
|---|
| >3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A | Back alignment and structure |
|---|
| >1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A | Back alignment and structure |
|---|
| >2lz1_A Nuclear factor erythroid 2-related factor 2; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... | Back alignment and structure |
|---|
| >2wuj_A Septum site-determining protein diviva; bacterial cell division, septation, cell cycle, sporulation; 1.40A {Bacillus subtilis} PDB: 2wuk_A | Back alignment and structure |
|---|
| >1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_A* | Back alignment and structure |
|---|
| >3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D | Back alignment and structure |
|---|
| >2zxx_A Geminin; coiled-coil, cell cycle, coiled coil, DNA replication inhibitor, phosphoprotein, DNA-binding, nucleus, proto-oncogene; HET: DNA; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2wvr_A Geminin; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* | Back alignment and structure |
|---|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1dip_A Delta-sleep-inducing peptide immunoreactive peptide; structure, leucine zipper, PIG, acetylation; NMR {Sus scrofa} SCOP: h.1.12.1 | Back alignment and structure |
|---|
| >2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B | Back alignment and structure |
|---|
| >1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1a93_B MAX protein, coiled coil, LZ; leucine zipper, 2D solution structure, H-bonds, buried salt bridge, proto-oncogene, nuclear protein; NMR {Mus musculus} SCOP: h.1.3.1 PDB: 2a93_B | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A | Back alignment and structure |
|---|
| >3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 | Back alignment and structure |
|---|
| >2j5u_A MREC protein; bacterial cell shape determining protein MREC, cell shape regulation; 2.5A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A | Back alignment and structure |
|---|
| >3w03_C DNA repair protein XRCC4; coiled-coil, NHEJ, DSBS repair, KU70/80, DNA-PKCS, DNA ligas binding protein; HET: DNA; 8.49A {Homo sapiens} | Back alignment and structure |
|---|
| >1zme_C Proline utilization transcription activator; complex (transcription regulation/DNA), PUT3, Zn2Cys6, binuclear cluster; HET: DNA 5IU; 2.50A {Saccharomyces cerevisiae} SCOP: g.38.1.1 h.1.3.1 PDB: 1ajy_A | Back alignment and structure |
|---|
| >2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} SCOP: h.1.28.1 | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A | Back alignment and structure |
|---|
| >2oa5_A Hypothetical protein BQLF2; MHR28B, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: PE5; 2.10A {Murid herpesvirus 4} SCOP: d.362.1.1 PDB: 2h3r_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 168 | |||
| d1sknp_ | 74 | Skn-1 {Caenorhabditis elegans [TaxId: 6239]} | 96.64 | |
| d1nkpa_ | 88 | Myc proto-oncogene protein {Human (Homo sapiens) [ | 92.86 | |
| d1nkpa_ | 88 | Myc proto-oncogene protein {Human (Homo sapiens) [ | 89.32 | |
| d1nkpb_ | 83 | Max protein {Human (Homo sapiens) [TaxId: 9606]} | 88.92 | |
| d1uklc_ | 61 | SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | 88.01 | |
| d1nlwa_ | 79 | Mad protein {Human (Homo sapiens) [TaxId: 9606]} | 86.87 | |
| d1nkpb_ | 83 | Max protein {Human (Homo sapiens) [TaxId: 9606]} | 85.83 | |
| d1am9a_ | 80 | SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | 85.08 | |
| d1nlwa_ | 79 | Mad protein {Human (Homo sapiens) [TaxId: 9606]} | 84.65 |
| >d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: A DNA-binding domain in eukaryotic transcription factors superfamily: A DNA-binding domain in eukaryotic transcription factors family: A DNA-binding domain in eukaryotic transcription factors domain: Skn-1 species: Caenorhabditis elegans [TaxId: 6239]
Probab=96.64 E-value=0.00039 Score=46.26 Aligned_cols=27 Identities=22% Similarity=0.465 Sum_probs=23.1
Q ss_pred HHHHHHHHHhHHHHHHHHHHHHHHHHH
Q 030957 88 NKRLKRLLRNRVSAQQARERKKAYLNE 114 (168)
Q Consensus 88 ~kr~rR~~rNR~AA~~sR~RKk~~~~~ 114 (168)
.+-++|+=+||+||+.||+||-...+.
T Consensus 47 irDIRRRGKNKvAAqnCRKRKld~~d~ 73 (74)
T d1sknp_ 47 IRKIRRRGKNKVAARTCRQRRTDRHDK 73 (74)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred HHHHHHhcccHHHHHHHHHhhhhhhcc
Confidence 567788999999999999999887654
|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|