Citrus Sinensis ID: 030994

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17

MASSREGHYRGVRKRPWGRYAAEIRDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPAPVTNSLPLDLNAPSDTNTSNQHRWITPGHHRHQRFGFCEFLQTGVLKEINFADRQATSASAQTDAAVIDGAPVADNGSTPSFFGIVRRGLPIDLNEPPPLWL

cccccccccccccccccccccEEEcccccccEEEECccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

***********VRKRPWGRYAAEIRDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPA*****************************************QT***KE*************************************VRRGLPIDLNEPPPLWL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASSREGHYRGVRKRPWGRYAAEIRDPWKKTRVWLGTFDTPEEAALAYDGAARSLRGAKAKTNFPAPVTNSLPLDLNAPSDTNTSNQHRWITPGHHRHQRFGFCEFLQTGVLKEINFADRQATSASAQTDAAVIDGAPVADNGSTPSFFGIVRRGLPIDLNEPPPLWL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ethylene-responsive transcription factor 12	Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways. Transcription factor that binds to the GCC-box pathogenesis-related promoter element. Acts as a transcriptional inhibitor and may regulate other AtERFs.	probable	Q94ID6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GCC, chain A
Confidence level:very confident
Coverage over the Query: 8-67
View the alignment between query and template
View the model in PyMOL