Citrus Sinensis ID: 031011

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------

MTADGGNQLISVHPEELKFIFELEKQGFCDLKVINNTEHHVAFKVKTTSPKKYFVRPNTGVVQPWDSCIIRVTLQAQRESPPDMQCKDKFLLQSTIVPSNTDVDDLPPDTFNKDSGKTIEECKLRVVYVSPSSAQGNLEDEGLVSATRSPDANSVSFGILLFALQFL

cccccccccEEEcccEEEEEcccccEEEEEEEEEcccccEEEEEEccccccCEEECccccccccccCEEEEEEECcccccccccccccCEEEEEEEcccccccccccccccccccccCEEEEEcEEEEccccccccccccccccccccccccccccccEEEEEEEcc

*********ISVHPEELKFIFELEKQGFCDLKVINNTEHHVAFKVKTTSPKKYFVRPNTGVVQPWDSCIIRVTLQAQRESPPDMQCKDKFLLQSTIVPSNTDVDDLP*****KD**KTIEECKLRVVYV*******************************LFALQFL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MTADGGNQLISVHPEELKFIFELEKQGFCDLKVINNTEHHVAFKVKTTSPKKYFVRPNTGVVQPWDSCIIRVTLQAQRESPPDMQCKDKFLLQSTIVPSNTDVDDLPPDTFNKDSGKTIEECKLRVVYVSPSSAQGNLEDEGLVSATRSPDANSVSFGILLFALQFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Vesicle-associated protein 2-1	May play a role in vesicle trafficking.	probable	Q9LVU1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CRI, chain A
Confidence level:very confident
Coverage over the Query: 7-142
View the alignment between query and template
View the model in PyMOL