Citrus Sinensis ID: 031019

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------

MVSVAYVFSHRSTRFMYFHILPLTETPDSAKKKISGEKKISGSHDRDVALAEVEKEKRESFIKAWEESEKTKAENKAQKKLSAVAAWENSKKASLEAKLKKIEEQLERKKAEYAEKMKNKVALVHKEAEEKRAMVEARRGEDVLKAEEIAAKYRATGTTPKKLLGCF

cccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc

***VAYVFSHRSTRFMYFHILPLT****************************************W******KA**KAQKKLSAVAAWEN***************************************************************YRATGTTPKKLLGCF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVSVAYVFSHRSTRFMYFHILPLTETPDSAKKKISGEKKISGSHDRDVALAEVEKEKRESFIKAWEESEKTKAENKAQKKLSAVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVHKEAEEKRAMVEARRGEDVLKAEEIAAKYRATGTTPKKLLGCF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Uncharacterized protein At3g61260		probable	Q9M2D8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted