Citrus Sinensis ID: 031023


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------
METSLRYGKDSKALRIYAKEKIPIDSNTRLQVHGELDTRVGAPSYVSAMIRHFYPDLSASFGLGVQYDKHEKLRYTVRGKKVFPVTSTGLLSFNIKGRCEVDKEFKQRKSRGAAEFSWSIFNFQKDQDVRFKLGYEVVDKVPYMQIRENNWTVNADANGRWNVRYDL
cccEEEECccccEEEEEEEEEcccccccEEEEEEEEEccccccHHHHHHHHHHccccccccCEEEEEECccCEEEEEEEEEEEECcccccEEEEEccEEECcccccccccCEEEEEEEEEcccccccEEEEEEcEEECcccccEEEEEccEEEEEccccCEEEEEcc
***S*********LRIYAKEKIPIDSNTRLQVHGELDTRVGAPSYVSAMIRHFYPDLSASFGLGVQYDKHEKLRYTVRGKKVFPVTSTGLLSFNIKGRCEVDK*********AAEFSWSIFNFQKDQDVRFKLGYEVVDKVPYMQIRENNWTVNADANGRWNVRYDL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METSLRYGKDSKALRIYAKEKIPIDSNTRLQVHGELDTRVGAPSYVSAMIRHFYPDLSASFGLGVQYDKHEKLRYTVRGKKVFPVTSTGLLSFNIKGRCEVDKEFKQRKSRGAAEFSWSIFNFQKDQDVRFKLGYEVVDKVPYMQIRENNWTVNADANGRWNVRYDL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Outer envelope pore protein 21B, chloroplastic Voltage-dependent rectifying anion channel that facilitates the translocation between chloroplast and cytoplasm of phosphorylated carbohydrates such as triosephosphate, 3-phosphoglycerate and inorganic phosphate (Pi) depending of ATP to triosephosphate ratio in the plastidial intermembrane space; in high triosephosphate/ATP conditions (e.g. photosynthesis), export of triosphophate from chloroplast (outward rectifying channels), but in high ATP/triosephosphate conditions (e.g. dark phase), import of phosphosolutes (inward rectifying channels).probableQ9FPG2
Outer envelope pore protein 21, chloroplastic Voltage-dependent rectifying anion channel that facilitates the translocation between chloroplast and cytoplasm of phosphorylated carbohydrates such as triosephosphate, 3-phosphoglycerate and inorganic phosphate (Pi) depending of ATP to triosephosphate ratio in the plastidial intermembrane space; in high triosephosphate/ATP conditions (e.g. photosynthesis), export of triosphophate from chloroplast (outward rectifying channels), but in high ATP/triosephosphate conditions (e.g. dark phase), import of phosphosolutes (inward rectifying channels).probableQ9SM57
Outer envelope pore protein 21, chloroplastic Voltage-dependent rectifying anion channel that facilitates the translocation between chloroplast and cytoplasm of phosphorylated carbohydrates such as triosephosphate, 3-phosphoglycerate and inorganic phosphate (Pi) depending of ATP to triosephosphate ratio in the plastidial intermembrane space; in high triosephosphate/ATP conditions (e.g. photosynthesis), export of triosphophate from chloroplast (outward rectifying channels), but in high ATP/triosephosphate conditions (e.g. dark phase), import of phosphosolutes (inward rectifying channels).probableQ6K965

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted