Citrus Sinensis ID: 031071

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
MFPASQIELPFNENDSQDMVIYQVINESTAQNISFMPQRSEVHTSSMLEPKRTISKKHYRGVRRRPWGKFAAEIRDSARHGQRIWLGTFETAEEAALAYDRAAFRMRGAKALLNFPAEVVAAPCPSSSPSLEKSNVKLSSILENNPEVSGSSSSTVSTATQRSESE
ccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHccccccccEEEEcccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
****SQIELPFNENDSQDMVIYQVIN********************************YRGVRRRPWGKFAAEIRDSARHGQRIWLGTFETAEEAALAYDRAAFRMRGAKALLNFPAEVV**********************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFPASQIELPFNENDSQDMVIYQVINESTAQNISFMPQRSEVHTSSMLEPKRTISKKHYRGVRRRPWGKFAAEIRDSARHGQRIWLGTFETAEEAALAYDRAAFRMRGAKALLNFPAEVVAAPCPSSSPSLEKSNVKLSSILENNPEVSGSSSSTVSTATQRSESE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pathogenesis-related genes transcriptional activator PTI5 Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. Activates plants defense genes. Can confer resistance to Pseudomonas syringae tomato by potentiating the transcription of a set of pathogenesis related genes, downstream to a defense signaling pathway involving PTO and PRF, but probably independent of ethylene, jasmonate and salicylic acid.probableO04681

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GCC, chain A
Confidence level:very confident
Coverage over the Query: 58-119
View the alignment between query and template
View the model in PyMOL