Citrus Sinensis ID: 031081

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------

MEFELGEGWIFQKICQRVAGCLVAEPIKEGFKLLSCFGDERTDGRILKKCRSHSATLQFGEISLQREVIKRASSVHSSNAVDEKHNGTIMCENEAVPAVCGIRAIWVTPSNRRKGIASLLLDAVRRSFCGEIVLEKSQLAFSQPSSAGKALASNYFGTASFLVYRT

cccccccEEEEEEcccEEEEEEEEEEcccEEEEEEcccccccccccccccccccccccccccHHEEEEEHHccccccccccccccccEEEEccccEEEEEEEcEEEEccccccccHHHHHHHHHHHHccccEEEccccEEEccccHHHHHHHHHHHccccEEEEEc

ccccccccEEEEEcccEEEEEEEEccHHHHEEEccccccccccccccccccccccEEEEEEEEEEEEEEEEEccccccccccccccccEEEccccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHccEEcEEEcHcHEEEccccccHHHHHHHHcccccEEEEEc

mefelgegWIFQKICQRVAGCLVAEPIKEGFKLLScfgdertdgrilkkcrshsatlqfgeISLQREVIKRASSvhssnavdekhngtimceneavpaVCGIRaiwvtpsnrrkGIASLLLDAVRRSFCGEIVLEKsqlafsqpssagkALASNYFGTASFLVYRT

mefelgegwiFQKICQRVAGCLVAEPIKEGFKLLSCFGDERTDGRILKKcrshsatlqfgeislQREVIKRAssvhssnavdekhngtiMCENEAVPAVCGIRAiwvtpsnrrKGIASLLLDAVRRSFCGEIVLEKSQLAFSQPSSAGKALASNYFGTasflvyrt

MEFELGEGWIFQKICQRVAGCLVAEPIKEGFKLLSCFGDERTDGRILKKCRSHSATLQFGEISLQREVIKRASSVHSSNAVDEKHNGTIMCENEAVPAVCGIRAIWVTPSNRRKGIASLLLDAVRRSFCGEIVLEKSQLAFSQPSSAGKALASNYFGTASFLVYRT

****LGEGWIFQKICQRVAGCLVAEPIKEGFKLLSCFGDERTDGRILKKCRSHSATLQFGEISLQREVI****************NGTIMCENEAVPAVCGIRAIWVTPSNRRKGIASLLLDAVRRSFCGEIVLEKSQLAF********ALASNYFGTASFLVY**

***ELGEGWIFQKICQRVAGCLVAEPIKEGFKLLS*********************LQFGEISLQREV***************KHNGTIMCENEAVPAVCGIRAIWVTPSNRRKGIASLLLDAVRRSFCGEIVLEKSQLAFSQPSSAGKALASNYFGTASFLVYRT

MEFELGEGWIFQKICQRVAGCLVAEPIKEGFKLLSCFGDERTDGRILKKCRSHSATLQFGEISLQREVIK***********DEKHNGTIMCENEAVPAVCGIRAIWVTPSNRRKGIASLLLDAVRRSFCGEIVLEKSQLA********KALASNYFGTASFLVYRT

****LGEGWIFQKICQRVAGCLVAEPIKEGFKLLSC****************HSATLQFGEISLQREVIKRASSVH********HNGTIMCENEAVPAVCGIRAIWVTPSNRRKGIASLLLDAVRRSFCGEIVLEKSQLAFSQPSSAGKALASNYFGTASFLVYRT

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEFELGEGWIFQKICQRVAGCLVAEPIKEGFKLLSCFGDERTDGRILKKCRSHSATLQFGEISLQREVIKRASSVHSSNAVDEKHNGTIMCENEAVPAVCGIRAIWVTPSNRRKGIASLLLDAVRRSFCGEIVLEKSQLAFSQPSSAGKALASNYFGTASFLVYRT

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		166	2.2.26 [Sep-21-2011]
Q8CIB9		592	N-acetyltransferase ESCO2	yes	no	0.644	0.180	0.328	3e-13
Q56NI9		601	N-acetyltransferase ESCO2	yes	no	0.674	0.186	0.335	1e-12
Q69Z69		843	N-acetyltransferase ESCO1	no	no	0.445	0.087	0.445	3e-11
Q5FWF5		840	N-acetyltransferase ESCO1	no	no	0.445	0.088	0.445	4e-11
Q5SPR8		609	N-acetyltransferase ESCO2	no	no	0.734	0.200	0.301	7e-11
Q9VS50		1052	N-acetyltransferase eco O	yes	no	0.457	0.072	0.402	4e-09
Q6C668		271	N-acetyltransferase ECO1	yes	no	0.403	0.247	0.434	1e-07
O42917		872	N-acetyltransferase eso1	yes	no	0.469	0.089	0.413	2e-07
Q6BJY5		288	N-acetyltransferase ECO1	yes	no	0.343	0.197	0.456	7e-06
Q6FQ55		261	N-acetyltransferase ECO1	yes	no	0.343	0.218	0.491	8e-06

>sp\|Q8CIB9\|ESCO2_MOUSE N-acetyltransferase ESCO2 OS=Mus musculus GN=Esco2 PE=2 SV=3	Back alignment and function desciption

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 49/149 (32%), Positives = 65/149 (43%), Gaps = 42/149 (28%)

Query: 16  QRVAGCLVAEPIKEGFKLLSCFGDERTDGRILKKCRSHSATLQFGEISLQREVIKRASSV 75
           +RV GCL+AEPIK+ F++LS                         E S  +E  +     
Sbjct: 482 KRVVGCLIAEPIKQAFRVLS-------------------------EPSASKECSR----- 511

Query: 76  HSSNAVDEKHNGTIMCENEAVPAVCGIRAIWVTPSNRRKGIASLLLDAVRRSFCGEIVLE 135
                          C +   PA+CGI  IWV    RRK IA  L+D VR  F     L 
Sbjct: 512 ------------AWRCSDVPEPAICGISRIWVFRLKRRKRIARRLVDTVRNCFMFGCFLS 559

Query: 136 KSQLAFSQPSSAGKALASNYFGTASFLVY 164
            +++AFS P+  GK  A+ Y  T +FLVY
Sbjct: 560 TNEIAFSDPTPDGKLFATKYCNTPNFLVY 588

Acetyltransferase required for the establishment of sister chromatid cohesion. Couples the processes of cohesion and DNA replication to ensure that only sister chromatids become paired together. In contrast to the structural cohesins, the deposition and establishment factors are required only during the S phase. Acetylates the cohesin component SMC3.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: -

>sp\|Q56NI9\|ESCO2_HUMAN N-acetyltransferase ESCO2 OS=Homo sapiens GN=ESCO2 PE=1 SV=1	Back alignment and function description

>sp\|Q69Z69\|ESCO1_MOUSE N-acetyltransferase ESCO1 OS=Mus musculus GN=Esco1 PE=2 SV=2	Back alignment and function description

>sp\|Q5FWF5\|ESCO1_HUMAN N-acetyltransferase ESCO1 OS=Homo sapiens GN=ESCO1 PE=1 SV=3	Back alignment and function description

>sp\|Q5SPR8\|ESCO2_DANRE N-acetyltransferase ESCO2 OS=Danio rerio GN=esco2 PE=2 SV=1	Back alignment and function description

>sp\|Q9VS50\|ECO_DROME N-acetyltransferase eco OS=Drosophila melanogaster GN=eco PE=1 SV=1	Back alignment and function description

>sp\|Q6C668\|ECO1_YARLI N-acetyltransferase ECO1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ECO1 PE=3 SV=1	Back alignment and function description

>sp\|O42917\|ESO1_SCHPO N-acetyltransferase eso1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eso1 PE=1 SV=1	Back alignment and function description

>sp\|Q6BJY5\|ECO1_DEBHA N-acetyltransferase ECO1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ECO1 PE=3 SV=2	Back alignment and function description

>sp\|Q6FQ55\|ECO1_CANGA N-acetyltransferase ECO1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ECO1 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		166
225428940		372	PREDICTED: N-acetyltransferase ESCO2 [Vi	1.0	0.446	0.649	2e-57
224138338		281	predicted protein [Populus trichocarpa]	0.993	0.587	0.635	9e-57
297735770		374	unnamed protein product [Vitis vinifera]	1.0	0.443	0.637	7e-56
225443353		392	PREDICTED: N-acetyltransferase ESCO2-lik	1.0	0.423	0.626	3e-55
255583582		379	conserved hypothetical protein [Ricinus	0.993	0.435	0.595	2e-51
297802888		344	hypothetical protein ARALYDRAFT_491601 [	0.945	0.456	0.571	4e-44
449437458		361	PREDICTED: N-acetyltransferase ESCO2-lik	0.993	0.457	0.528	9e-44
145350620		345	N-acetyltransferase [Arabidopsis thalian	0.951	0.457	0.568	6e-43
356572623		347	PREDICTED: N-acetyltransferase ESCO2-lik	0.939	0.449	0.529	7e-41
356572615		347	PREDICTED: N-acetyltransferase ESCO2-lik	0.939	0.449	0.523	3e-40

>gi\|225428940\|ref\|XP_002263529.1\| PREDICTED: N-acetyltransferase ESCO2 [Vitis vinifera] gi\|296083078\|emb\|CBI22482.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 113/174 (64%), Positives = 132/174 (75%), Gaps = 8/174 (4%)

Query: 1   MEFELGEGWIFQK--------ICQRVAGCLVAEPIKEGFKLLSCFGDERTDGRILKKCRS 52
           ME ELG  WIF K          QRVAGCLVAEPIK+ +K+LS   DER++    K+ R 
Sbjct: 196 MEIELGGAWIFHKNRKVYLFISSQRVAGCLVAEPIKKAYKILSSSADERSNDTSSKETRP 255

Query: 53  HSATLQFGEISLQREVIKRASSVHSSNAVDEKHNGTIMCENEAVPAVCGIRAIWVTPSNR 112
           +S TLQFG +S QREVIKRA SV+S   +D + NG ++CENEAVPA+CGIRAIWVTPSNR
Sbjct: 256 NSNTLQFGTVSFQREVIKRAPSVNSCEVLDGRPNGPVVCENEAVPAICGIRAIWVTPSNR 315

Query: 113 RKGIASLLLDAVRRSFCGEIVLEKSQLAFSQPSSAGKALASNYFGTASFLVYRT 166
           RK IAS LLDAVR+SFC   VL+ SQLAFSQP+SAG ALASNYFG+ SFLVY+T
Sbjct: 316 RKHIASQLLDAVRKSFCMGFVLKSSQLAFSQPTSAGMALASNYFGSGSFLVYKT 369

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224138338\|ref\|XP_002322789.1\| predicted protein [Populus trichocarpa] gi\|222867419\|gb\|EEF04550.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297735770\|emb\|CBI18457.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225443353\|ref\|XP_002266283.1\| PREDICTED: N-acetyltransferase ESCO2-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255583582\|ref\|XP_002532547.1\| conserved hypothetical protein [Ricinus communis] gi\|223527736\|gb\|EEF29841.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|297802888\|ref\|XP_002869328.1\| hypothetical protein ARALYDRAFT_491601 [Arabidopsis lyrata subsp. lyrata] gi\|297315164\|gb\|EFH45587.1\| hypothetical protein ARALYDRAFT_491601 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|449437458\|ref\|XP_004136509.1\| PREDICTED: N-acetyltransferase ESCO2-like [Cucumis sativus] gi\|449515408\|ref\|XP_004164741.1\| PREDICTED: N-acetyltransferase ESCO2-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|145350620\|ref\|NP_194868.2\| N-acetyltransferase [Arabidopsis thaliana] gi\|156254746\|gb\|ABU62813.1\| cohesion establishment factor 7 [Arabidopsis thaliana] gi\|332660505\|gb\|AEE85905.1\| N-acetyltransferase [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|356572623\|ref\|XP_003554467.1\| PREDICTED: N-acetyltransferase ESCO2-like [Glycine max]	Back alignment and taxonomy information

>gi\|356572615\|ref\|XP_003554463.1\| PREDICTED: N-acetyltransferase ESCO2-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		166
TAIR\|locus:2128126		345	CTF7 [Arabidopsis thaliana (ta	0.945	0.455	0.571	2.5e-42
UNIPROTKB\|F1NGQ2		524	F1NGQ2 "Uncharacterized protei	0.584	0.185	0.402	7e-17
UNIPROTKB\|Q56NI9		601	ESCO2 "N-acetyltransferase ESC	0.590	0.163	0.398	8.7e-16
UNIPROTKB\|F1RJS0		611	ESCO2 "Uncharacterized protein	0.445	0.121	0.459	9e-16
UNIPROTKB\|G3MWW4		211	LOC786089 "Uncharacterized pro	0.391	0.308	0.446	1.1e-15
UNIPROTKB\|A6QNP8		610	ESCO2 "ESCO2 protein" [Bos tau	0.445	0.121	0.445	1.9e-15
UNIPROTKB\|J9NWF6		598	ESCO2 "Uncharacterized protein	0.445	0.123	0.445	2.3e-15
UNIPROTKB\|F1PA26		602	ESCO2 "Uncharacterized protein	0.445	0.122	0.445	2.3e-15
RGD\|1596873		319	Esco1 "establishment of cohesi	0.445	0.231	0.445	2.7e-15
DICTYBASE\|DDB_G0279959		441	eco1 "establishment of cohesio	0.493	0.185	0.390	6.7e-15

TAIR\|locus:2128126 CTF7 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 448 (162.8 bits), Expect = 2.5e-42, P = 2.5e-42
 Identities = 100/175 (57%), Positives = 121/175 (69%)

Query:     1 MEFELGEGWIFQKIC--------QRVAGCLVAEPIKEGFKLLSCFGDERTDGRILKKCRS 52
             ME ELGE WI  + C        QR++GCLVAEPIKE FKL++   DER   ++ K+  S
Sbjct:   170 MEVELGEDWILHQHCKVYLFISSQRISGCLVAEPIKEAFKLIASPDDER---QLQKESSS 226

Query:    53 HSAT-LQFGEISLQREVIKRASSVHSSNAVDEKHNGTIMCENEAVPAVCGIRAIWVTPSN 111
               +T +QFG I LQREV KR  +  S + +D   NG I+CE EA PAVCGIRAIWV+PSN
Sbjct:   227 SPSTSIQFGNIVLQREVSKRCRT--SDDRLD---NGVIVCEEEAKPAVCGIRAIWVSPSN 281

Query:   112 RRKGIASLLLDAVRRSFCGE-IVLEKSQLAFSQPSSAGKALASNYFGTASFLVYR 165
             RRKGIA+ LLD  R SFC    +LEKSQLAFSQPSS G++  S YFGT SFL+Y+
Sbjct:   282 RRKGIATWLLDTTRESFCNNGCMLEKSQLAFSQPSSIGRSFGSKYFGTCSFLLYK 336

GO:0003684 "damaged DNA binding" evidence=IEA

GO:0003887 "DNA-directed DNA polymerase activity" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0006281 "DNA repair" evidence=IEA

GO:0007062 "sister chromatid cohesion" evidence=IMP

GO:0009553 "embryo sac development" evidence=IMP

GO:0009790 "embryo development" evidence=IMP

UNIPROTKB\|F1NGQ2 F1NGQ2 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q56NI9 ESCO2 "N-acetyltransferase ESCO2" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RJS0 ESCO2 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|G3MWW4 LOC786089 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|A6QNP8 ESCO2 "ESCO2 protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|J9NWF6 ESCO2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PA26 ESCO2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

RGD\|1596873 Esco1 "establishment of cohesion 1 homolog 1 (S. cerevisiae)" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0279959 eco1 "establishment of cohesion 1" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.3.1	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		166
pfam13880		70	pfam13880, Acetyltransf_13, ESCO1/2 acetyl-transfe	3e-36

>gnl\|CDD\|206051 pfam13880, Acetyltransf_13, ESCO1/2 acetyl-transferase	Back alignment and domain information

 Score =  119 bits (301), Expect = 3e-36
 Identities = 43/70 (61%), Positives = 51/70 (72%)

Query: 95  AVPAVCGIRAIWVTPSNRRKGIASLLLDAVRRSFCGEIVLEKSQLAFSQPSSAGKALASN 154
            VPA+CGI  IWV+PS+RRKGIA+ LLDAVR +F     L K Q+AFSQP+ +GKA A  
Sbjct: 1   PVPALCGISRIWVSPSHRRKGIATRLLDAVRSNFIYGYELPKEQIAFSQPTESGKAFARK 60

Query: 155 YFGTASFLVY 164
           Y GT  FLVY
Sbjct: 61  YCGTDDFLVY 70

Length = 70

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		166
KOG3014		257	consensus Protein involved in establishing cohesio	100.0
PF13880		70	Acetyltransf_13: ESCO1/2 acetyl-transferase	100.0
PF00583		83	Acetyltransf_1: Acetyltransferase (GNAT) family; I	97.51
PF05301		120	Mec-17: Touch receptor neuron protein Mec-17; Inte	97.21
PF13673		117	Acetyltransf_10: Acetyltransferase (GNAT) domain;	97.03
PHA01807		153	hypothetical protein	96.74
PF13508		79	Acetyltransf_7: Acetyltransferase (GNAT) domain; P	96.74
TIGR02406		157	ectoine_EctA L-2,4-diaminobutyric acid acetyltrans	96.7
PRK10146		144	aminoalkylphosphonic acid N-acetyltransferase; Pro	96.6
COG0456		177	RimI Acetyltransferases [General function predicti	96.49
PRK03624		140	putative acetyltransferase; Provisional	96.43
cd04301		65	NAT_SF N-Acyltransferase superfamily: Various enzy	96.4
PHA00673		154	acetyltransferase domain containing protein	96.34
PF08445		86	FR47: FR47-like protein; InterPro: IPR013653 Prote	96.28
PRK10514		145	putative acetyltransferase; Provisional	96.22
COG0454		156	WecD Histone acetyltransferase HPA2 and related ac	96.22
TIGR01575		131	rimI ribosomal-protein-alanine acetyltransferase.	96.19
PF13527		127	Acetyltransf_9: Acetyltransferase (GNAT) domain; P	96.18
PTZ00330		147	acetyltransferase; Provisional	96.18
PLN02706		150	glucosamine 6-phosphate N-acetyltransferase	96.16
PRK09831		147	putative acyltransferase; Provisional	96.14
PRK13688		156	hypothetical protein; Provisional	96.1
TIGR03448		292	mycothiol_MshD mycothiol biosynthesis acetyltransf	96.04
PRK10314		153	putative acyltransferase; Provisional	96.03
PRK07757		152	acetyltransferase; Provisional	95.93
PRK10140		162	putative acetyltransferase YhhY; Provisional	95.83
PF14542		78	Acetyltransf_CG: GCN5-related N-acetyl-transferase	95.66
COG3393		268	Predicted acetyltransferase [General function pred	95.54
PRK10562		145	putative acetyltransferase; Provisional	95.4
PRK07922		169	N-acetylglutamate synthase; Validated	95.32
KOG3139		165	consensus N-acetyltransferase [General function pr	95.25
PRK01346		411	hypothetical protein; Provisional	95.02
TIGR03827		266	GNAT_ablB putative beta-lysine N-acetyltransferase	95.02
PRK09491		146	rimI ribosomal-protein-alanine N-acetyltransferase	94.81
PRK10809		194	ribosomal-protein-S5-alanine N-acetyltransferase;	94.51
KOG4601		264	consensus Uncharacterized conserved protein [Funct	94.4
cd02169		297	Citrate_lyase_ligase Citrate lyase ligase. Citrate	94.21
PF13718		196	GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z	93.78
TIGR02382		191	wecD_rffC TDP-D-fucosamine acetyltransferase. This	93.4
PRK15130		186	spermidine N1-acetyltransferase; Provisional	93.36
PF13523		152	Acetyltransf_8: Acetyltransferase (GNAT) domain; P	93.2
PRK12308		614	bifunctional argininosuccinate lyase/N-acetylgluta	93.09
PRK10975		194	TDP-fucosamine acetyltransferase; Provisional	93.08
KOG3216		163	consensus Diamine acetyltransferase [Amino acid tr	92.96
PRK05279		441	N-acetylglutamate synthase; Validated	92.93
TIGR03103		547	trio_acet_GNAT GNAT-family acetyltransferase TIGR0	92.36
TIGR03448		292	mycothiol_MshD mycothiol biosynthesis acetyltransf	92.24
TIGR01890		429	N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi	92.19
PF13302		142	Acetyltransf_3: Acetyltransferase (GNAT) domain; P	91.69
PF13420		155	Acetyltransf_4: Acetyltransferase (GNAT) domain; P	90.63
PRK10151		179	ribosomal-protein-L7/L12-serine acetyltransferase;	90.54
COG1247		169	Sortase and related acyltransferases [Cell envelop	90.19
PLN02825		515	amino-acid N-acetyltransferase	89.92
TIGR00124		332	cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP	89.6
COG1444		758	Predicted P-loop ATPase fused to an acetyltransfer	89.41
COG2388		99	Predicted acetyltransferase [General function pred	89.04
TIGR03585		156	PseH pseudaminic acid biosynthesis N-acetyl transf	87.21
TIGR01686		320	FkbH FkbH-like domain. The C-terminal portion of t	86.96
PF12568		128	DUF3749: Acetyltransferase (GNAT) domain; InterPro	83.79
KOG2488		202	consensus Acetyltransferase (GNAT) domain-containi	83.56
COG1670		187	RimL Acetyltransferases, including N-acetylases of	82.37
KOG3138		187	consensus Predicted N-acetyltransferase [General f	81.88
KOG3235		193	consensus Subunit of the major N alpha-acetyltrans	81.78

>KOG3014 consensus Protein involved in establishing cohesion between sister chromatids during DNA replication [Replication, recombination and repair]	Back alignment and domain information

Probab=100.00  E-value=3.3e-40  Score=280.33  Aligned_cols=125  Identities=42%  Similarity=0.687  Sum_probs=111.8

Q ss_pred             CccccCCcccccc---cC---------ceeeEEEeeeeccccccccccCCCCCCcccccccccCCCcccccchhhHHHHH
Q 031081            1 MEFELGEGWIFQK---IC---------QRVAGCLVAEPIKEGFKLLSCFGDERTDGRILKKCRSHSATLQFGEISLQREV   68 (166)
Q Consensus         1 ~e~Elg~~wil~~---~~---------~rVvGClvAE~I~~A~rvi~~~~~~~~~~~~~~e~~~~s~tl~fg~i~~~rev   68 (166)
                      |+.|||..|+.++   .+         +.||||||||||++||+++..+..  .+                         
T Consensus       113 VnnELg~~~~~~~~~~~~k~~lFIS~rk~~VGcLvaE~Is~a~~~i~~~~~--~~-------------------------  165 (257)
T KOG3014|consen  113 VNNELGYQQIENQCWPKIKTFLFISVRKIVVGCLVAEPISQAFRVIESPGV--TD-------------------------  165 (257)
T ss_pred             HHhhcCCcccccccccceeEEEEEEecceeeeEEEehhhhhhhhhccCcCc--cc-------------------------
Confidence            6889999999998   43         557999999999999999986641  00                         


Q ss_pred             HHhhcccCCCccccccCCCeeEeecceeceeeeeeEEEeCCCCcccCHHHHHHHHHHHhccccccccCCceeecCCChhH
Q 031081           69 IKRASSVHSSNAVDEKHNGTIMCENEAVPAVCGIRAIWVTPSNRRKGIASLLLDAVRRSFCGEIVLEKSQLAFSQPSSAG  148 (166)
Q Consensus        69 ~~~~~~~~~~~~~~~~~~~~~~cs~~p~pa~~GI~rIWV~~~~RRkGIAt~Lld~~r~~fiyG~~l~~~eiAFSqPT~~G  148 (166)
                                   +.+.+.+|+||+.|.|++|||+||||++..||+|||++|||+|+++|+||+.+++.+|||||||++|
T Consensus       166 -------------~~~s~~~~~~s~~~~~~~~GIsRIWV~s~~Rr~gIAs~lldva~~~~~~g~~isr~~iAfs~PTddG  232 (257)
T KOG3014|consen  166 -------------SYDSQKAWQNSPLPEPAICGISRIWVSSLRRRKGIASLLLDVARCNFVYGEVISREEIAFSDPTDDG  232 (257)
T ss_pred             -------------chhhHHHhccCCCCCCcEeeeEEEEeehhhhhhhhHHHHHHHHHHhhhhhcccchhheEecCCCchh
Confidence                         0112367899999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhCCCceEeec
Q 031081          149 KALASNYFGTASFLVYR  165 (166)
Q Consensus       149 ~~fA~~y~~~~~flVY~  165 (166)
                      ++||++|+|+.+|++|+
T Consensus       233 k~lAt~~~~t~~~~~~~  249 (257)
T KOG3014|consen  233 KKLATKYCGTRNFLTYN  249 (257)
T ss_pred             HHHHHHHhCccchhhhh
Confidence            99999999999999986

>PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase	Back alignment and domain information

>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2	Back alignment and domain information

>PF05301 Mec-17: Touch receptor neuron protein Mec-17; InterPro: IPR007965 Mec-17 is the protein product of one of the 18 genes required for the development and function of the touch receptor neuron for gentle touch	Back alignment and domain information

>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A	Back alignment and domain information

>PHA01807 hypothetical protein	Back alignment and domain information

>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A	Back alignment and domain information

>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase	Back alignment and domain information

>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional	Back alignment and domain information

>COG0456 RimI Acetyltransferases [General function prediction only]	Back alignment and domain information

>PRK03624 putative acetyltransferase; Provisional	Back alignment and domain information

>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate	Back alignment and domain information

>PHA00673 acetyltransferase domain containing protein	Back alignment and domain information

>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT)	Back alignment and domain information

>PRK10514 putative acetyltransferase; Provisional	Back alignment and domain information

>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only]	Back alignment and domain information

>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase	Back alignment and domain information

>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B	Back alignment and domain information

>PTZ00330 acetyltransferase; Provisional	Back alignment and domain information

>PLN02706 glucosamine 6-phosphate N-acetyltransferase	Back alignment and domain information

>PRK09831 putative acyltransferase; Provisional	Back alignment and domain information

>PRK13688 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase	Back alignment and domain information

>PRK10314 putative acyltransferase; Provisional	Back alignment and domain information

>PRK07757 acetyltransferase; Provisional	Back alignment and domain information

>PRK10140 putative acetyltransferase YhhY; Provisional	Back alignment and domain information

>PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A	Back alignment and domain information

>COG3393 Predicted acetyltransferase [General function prediction only]	Back alignment and domain information

>PRK10562 putative acetyltransferase; Provisional	Back alignment and domain information

>PRK07922 N-acetylglutamate synthase; Validated	Back alignment and domain information

>KOG3139 consensus N-acetyltransferase [General function prediction only]	Back alignment and domain information

>PRK01346 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase	Back alignment and domain information

>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional	Back alignment and domain information

>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional	Back alignment and domain information

>KOG4601 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>cd02169 Citrate_lyase_ligase Citrate lyase ligase	Back alignment and domain information

>PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B	Back alignment and domain information

>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase	Back alignment and domain information

>PRK15130 spermidine N1-acetyltransferase; Provisional	Back alignment and domain information

>PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A	Back alignment and domain information

>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional	Back alignment and domain information

>PRK10975 TDP-fucosamine acetyltransferase; Provisional	Back alignment and domain information

>KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK05279 N-acetylglutamate synthase; Validated	Back alignment and domain information

>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103	Back alignment and domain information

>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase	Back alignment and domain information

>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase	Back alignment and domain information

>PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A	Back alignment and domain information

>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A	Back alignment and domain information

>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional	Back alignment and domain information

>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PLN02825 amino-acid N-acetyltransferase	Back alignment and domain information

>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase	Back alignment and domain information

>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]	Back alignment and domain information

>COG2388 Predicted acetyltransferase [General function prediction only]	Back alignment and domain information

>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase	Back alignment and domain information

>TIGR01686 FkbH FkbH-like domain	Back alignment and domain information

>PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length	Back alignment and domain information

>KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only]	Back alignment and domain information

>COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG3138 consensus Predicted N-acetyltransferase [General function prediction only]	Back alignment and domain information

>KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		166
2q0y_A		153	GCN5-related N-acetyltransferase; YP_295895.1, ace	6e-04
3ey5_A		181	Acetyltransferase-like, GNAT family; structural ge	9e-04

>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Length = 153	Back alignment and structure

 Score = 37.5 bits (87), Expect = 6e-04
 Identities = 10/43 (23%), Positives = 19/43 (44%), Gaps = 4/43 (9%)

Query: 102 IRAIWVTPSNRRKGIASLLLDAV----RRSFCGEIVLEKSQLA 140
           I  ++V PS+R +GI   L++              VL  +++ 
Sbjct: 90  ILNLYVDPSHRERGIGQALMNRAEAEFAERGIAFAVLHATEMG 132

PyMOL of 2q0y

>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Length = 181	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		166
2k5t_A		128	Uncharacterized protein YHHK; N-acetyl transferase	97.52
2q0y_A		153	GCN5-related N-acetyltransferase; YP_295895.1, ace	97.49
3fnc_A		163	Protein LIN0611, putative acetyltransferase; GNAT,	97.45
1qsm_A		152	HPA2 histone acetyltransferase; protein-acetyl coe	97.4
1z4e_A		153	Transcriptional regulator; nysgxrc target T2017, G	97.3
3gy9_A		150	GCN5-related N-acetyltransferase; YP_001815201.1,	97.27
3t90_A		149	Glucose-6-phosphate acetyltransferase 1; GNAT fold	97.22
3e0k_A		150	Amino-acid acetyltransferase; N-acetylglutamate sy	97.21
1r57_A		102	Conserved hypothetical protein; GCN5, N-acetyltran	97.19
2pdo_A		144	Acetyltransferase YPEA; alpha-beta-alpha sandwich,	97.18
2atr_A		138	Acetyltransferase, GNAT family; MCSG, structural g	97.17
3dsb_A		157	Putative acetyltransferase; APC60368.2, ST genomic	97.15
4e0a_A		164	BH1408 protein; structural genomics, PSI-biology,	97.15
4ag7_A		165	Glucosamine-6-phosphate N-acetyltransferase; HET:	97.14
3exn_A		160	Probable acetyltransferase; GCN5-related N-acetylt	97.14
3mgd_A		157	Predicted acetyltransferase; structural genomics,	97.12
2bei_A		170	Diamine acetyltransferase 2; SSAT2, BC011751, AAH1	97.12
3efa_A		147	Putative acetyltransferase; structural genom 2, pr	97.11
3jvn_A		166	Acetyltransferase; alpha-beta protein, structural	97.1
1wwz_A		159	Hypothetical protein PH1933; structural genomics,	97.1
1xmt_A		103	Putative acetyltransferase; structural genomics, p	97.1
3ey5_A		181	Acetyltransferase-like, GNAT family; structural ge	97.09
2fe7_A		166	Probable N-acetyltransferase; structural genomics,	97.08
2fia_A		162	Acetyltransferase; structural genomics, PSI, prote	97.08
3lod_A		162	Putative acyl-COA N-acyltransferase; structural ge	97.07
1cjw_A		166	Protein (serotonin N-acetyltransferase); HET: COT;	97.07
2i6c_A		160	Putative acetyltransferase; GNAT family, structura	97.07
2oh1_A		179	Acetyltransferase, GNAT family; YP_013287.1, struc	97.06
1y9w_A		140	Acetyltransferase; structural genomics, Pro struct	97.05
3t9y_A		150	Acetyltransferase, GNAT family; PSI-biology, struc	97.05
2qec_A		204	Histone acetyltransferase HPA2 and related acetylt	97.04
3s6f_A		145	Hypothetical acetyltransferase; acyl-COA N-acyltra	97.03
1tiq_A		180	Protease synthase and sporulation negative regulat	97.03
3i3g_A		161	N-acetyltransferase; malaria, structural genomics,	97.02
3d8p_A		163	Acetyltransferase of GNAT family; NP_373092.1, str	97.02
1u6m_A		199	Acetyltransferase, GNAT family; structural genomic	97.01
3bln_A		143	Acetyltransferase GNAT family; NP_981174.1, struct	97.0
2jdc_A		146	Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.	96.99
1qst_A		160	TGCN5 histone acetyl transferase; GCN5-related N-a	96.97
4evy_A		166	Aminoglycoside N(6')-acetyltransferase type 1; cen	96.95
1bo4_A		168	Protein (serratia marcescens aminoglycoside-3-N- a	96.95
2ozh_A		142	Hypothetical protein XCC2953; structural genomics,	96.94
2kcw_A		147	Uncharacterized acetyltransferase YJAB; GNAT fold,	96.94
2pr1_A		163	Uncharacterized N-acetyltransferase YLBP; YIBP pro	96.93
2eui_A		153	Probable acetyltransferase; dimer, structural geno	96.93
2g3a_A		152	Acetyltransferase; structural genomics, PSI, prote	96.93
1i12_A		160	Glucosamine-phosphate N-acetyltransferase; GNAT, a	96.93
4fd4_A		217	Arylalkylamine N-acetyltransferase like 5B; GNAT;	96.92
1y7r_A		133	Hypothetical protein SA2161; structural genomics,	96.92
1ghe_A		177	Acetyltransferase; acyl coenzyme A complex; HET: A	96.91
2dxq_A		150	AGR_C_4057P, acetyltransferase; structural genomic	96.91
3fyn_A		176	Integron gene cassette protein HFX_CASS3; integron	96.91
1q2y_A		140	Protein YJCF, similar to hypothetical proteins; GC	96.9
2cy2_A		174	TTHA1209, probable acetyltransferase; structural g	96.9
3dr6_A		174	YNCA; acetyltransferase, csgid target, essential g	96.89
2x7b_A		168	N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf	96.88
2fiw_A		172	GCN5-related N-acetyltransferase:aminotransferase	96.87
1xeb_A		150	Hypothetical protein PA0115; midwest center for st	96.87
1ufh_A		180	YYCN protein; alpha and beta, fold, acetyltransfer	96.87
1n71_A		180	AAC(6')-II; aminoglycoside 6'-N-acetyltransferase,	96.87
4h89_A		173	GCN5-related N-acetyltransferase; N-acyltransferas	96.86
2r7h_A		177	Putative D-alanine N-acetyltransferase of GNAT FA;	96.85
1m4i_A		181	Aminoglycoside 2'-N-acetyltransferase; COA binding	96.84
1s3z_A		165	Aminoglycoside 6'-N-acetyltransferase; GNAT, amino	96.84
1yr0_A		175	AGR_C_1654P, phosphinothricin acetyltransferase; s	96.83
2aj6_A		159	Hypothetical protein MW0638; structural genomics,	96.83
3d3s_A		189	L-2,4-diaminobutyric acid acetyltransferase; alpha	96.82
2cnt_A		160	Modification of 30S ribosomal subunit protein S18;	96.81
2b5g_A		171	Diamine acetyltransferase 1; structural genomics,	96.81
3i9s_A		183	Integron cassette protein; oyster POND, woods HOLE	96.79
1ygh_A		164	ADA4, protein (transcriptional activator GCN5); tr	96.78
3kkw_A		182	Putative uncharacterized protein; acetyltransferas	96.78
1z4r_A		168	General control of amino acid synthesis protein 5-	96.77
2r1i_A		172	GCN5-related N-acetyltransferase; YP_831484.1, put	96.74
2ob0_A		170	Human MAK3 homolog; acetyltransferase, structural	96.73
3fix_A		183	N-acetyltransferase; termoplasma acidophilum, stru	96.73
4b5o_A		200	Alpha-tubulin N-acetyltransferase; microtubules, c	96.73
1vkc_A		158	Putative acetyl transferase; structural genomics,	96.7
2o28_A		184	Glucosamine 6-phosphate N-acetyltransferase; struc	96.7
2vez_A		190	Putative glucosamine 6-phosphate acetyltransferase	96.69
2j8m_A		172	Acetyltransferase PA4866 from P. aeruginosa; GCN5	96.69
1mk4_A		157	Hypothetical protein YQJY; alpha-beta-alpha sandwi	96.68
3owc_A		188	Probable acetyltransferase; structural genomics, P	96.67
2ree_A		224	CURA; GNAT, S-acetyltransferase, decarboxylase, po	96.67
2ae6_A		166	Acetyltransferase, GNAT family; GCN5-related N-ace	96.67
4hkf_A		191	Alpha-tubulin N-acetyltransferase; tubulin acetylt	96.66
1y9k_A		157	IAA acetyltransferase; structural genomics, midwes	96.65
4h6u_A		200	Alpha-tubulin N-acetyltransferase; tubulin acetylt	96.64
3ld2_A		197	SMU.2055, putative acetyltransferase; HET: COA; 2.	96.61
2jlm_A		182	Putative phosphinothricin N-acetyltransferase; met	96.6
3pp9_A		187	Putative streptothricin acetyltransferase; toxin p	96.59
2fl4_A		149	Spermine/spermidine acetyltransferase; structural	96.58
2pc1_A		201	Acetyltransferase, GNAT family; NP_688560.1, struc	96.57
1kux_A		207	Aralkylamine, serotonin N-acetyltransferase; enzym	96.56
3igr_A		184	Ribosomal-protein-S5-alanine N-acetyltransferase;	96.52
1on0_A		158	YYCN protein; structural genomics, alpha-beta prot	96.52
3qb8_A		197	A654L protein; GNAT N-acetyltransferase, acetyltra	96.5
3f8k_A		160	Protein acetyltransferase; GCN5-related N-acetyltr	96.48
2gan_A		190	182AA long hypothetical protein; alpha-beta protei	96.46
2ge3_A		170	Probable acetyltransferase; structural GEN PSI, pr	96.45
3frm_A		254	Uncharacterized conserved protein; APC61048, staph	96.38
4gs4_A		240	Alpha-tubulin N-acetyltransferase; acetyl coenzyme	96.37
2bue_A		202	AAC(6')-IB; GNAT, transferase, aminoglycoside, flu	96.36
1yvk_A		163	Hypothetical protein BSU33890; ALPHS-beta protein,	96.36
1vhs_A		175	Similar to phosphinothricin acetyltransferase; str	96.35
2q04_A		211	Acetoin utilization protein; ZP_00540088.1, struct	96.35
3f5b_A		182	Aminoglycoside N(6')acetyltransferase; APC60744, l	96.35
4fd5_A		222	Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A	96.33
3juw_A		175	Probable GNAT-family acetyltransferase; structural	96.3
3fbu_A		168	Acetyltransferase, GNAT family; structur genomics,	96.29
1yx0_A		159	Hypothetical protein YSNE; NESG, GFT structral gen	96.28
2i79_A		172	Acetyltransferase, GNAT family; acetyl coenzyme *A	96.26
3eg7_A		176	Spermidine N1-acetyltransferase; structural genomi	96.25
3ec4_A		228	Putative acetyltransferase from the GNAT family; Y	96.25
3te4_A		215	GH12636P, dopamine N acetyltransferase, isoform A;	96.24
3tth_A		170	Spermidine N1-acetyltransferase; central intermedi	96.21
3eo4_A		164	Uncharacterized protein MJ1062; APC60792.2,MJ_1062	96.18
1nsl_A		184	Probable acetyltransferase; structural genomics, h	96.12
2q7b_A		181	Acetyltransferase, GNAT family; NP_689019.1, struc	96.0
3tt2_A		330	GCN5-related N-acetyltransferase; structural genom	95.93
1yre_A		197	Hypothetical protein PA3270; APC5563, midwest cent	95.81
1s7k_A		182	Acetyl transferase; GNAT; 1.80A {Salmonella typhim	95.77
3n7z_A		388	Acetyltransferase, GNAT family; PSI2, MCSG, struct	95.76
1bob_A		320	HAT1, histone acetyltransferase; histone modificat	95.74
3r9f_A		188	MCCE protein; microcin C7, acetyltransferase, SELF	95.67
2vi7_A		177	Acetyltransferase PA1377; GNAT, GCN5 family, N-ace	95.66
3ddd_A		288	Putative acetyltransferase; NP_142035.1, structura	95.63
2i00_A		406	Acetyltransferase, GNAT family; structural genomic	95.59
2fsr_A		195	Acetyltransferase; alpha-beta-sandwich, structural	95.57
2hv2_A		400	Hypothetical protein; PSI, protein structure initi	95.56
4fd7_A		238	Putative arylalkylamine N-acetyltransferase 7; GNA	95.55
2vzy_A		218	RV0802C; transferase, GCN5-related N-acetyltransfe	95.55
3sxn_A		422	Enhanced intracellular surviVal protein; GNAT fold	95.52
2wpx_A		339	ORF14; transferase, acetyl transferase, antibiotic	95.5
1p0h_A		318	Hypothetical protein RV0819; GNAT fold, acetyltran	95.45
3r1k_A		428	Enhanced intracellular surviVal protein; GNAT, ace	95.44
2wpx_A		339	ORF14; transferase, acetyl transferase, antibiotic	95.4
2fck_A		181	Ribosomal-protein-serine acetyltransferase, putat;	95.26
3tt2_A		330	GCN5-related N-acetyltransferase; structural genom	95.21
2ozg_A		396	GCN5-related N-acetyltransferase; YP_325469.1, ace	95.16
3g8w_A		169	Lactococcal prophage PS3 protein 05; APC61042, ace	95.14
3pzj_A		209	Probable acetyltransferases; MCSG, PSI-2, structur	95.12
2zw5_A		301	Bleomycin acetyltransferase; dimer, two domains; H	94.93
3iwg_A		276	Acetyltransferase, GNAT family; structural genomic	94.86
3c26_A		266	Putative acetyltransferase TA0821; NP_394282.1, A	94.84
3d2m_A		456	Putative acetylglutamate synthase; protein-COA-Glu	94.78
4ava_A		333	Lysine acetyltransferase; allosteric regulation, d	94.72
2z10_A		194	Ribosomal-protein-alanine acetyltransferase; alpha	94.46
1p0h_A		318	Hypothetical protein RV0819; GNAT fold, acetyltran	94.4
1sqh_A		312	Hypothetical protein CG14615-PA; structural genomi	94.38
2qml_A		198	BH2621 protein; structural genomics, joint center	94.22
2zpa_A		671	Uncharacterized protein YPFI; RNA modification enz	94.18
3g3s_A		249	GCN5-related N-acetyltransferase; ZP_00874857.1, a	93.83
3tcv_A		246	GCN5-related N-acetyltransferase; GRAM negative co	93.66
3h4q_A		188	Putative acetyltransferase; NP_371943.1, structura	92.71
2g0b_A		198	FEEM; N-acyl transferase, environmental DNA, prote	92.56
1yk3_A		210	Hypothetical protein RV1347C/MT1389; acyltransfera	91.78
2p0w_A		324	Histone acetyltransferase type B catalytic subuni;	87.45

>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12}	Back alignment and structure

Probab=97.52  E-value=7.1e-05  Score=53.09  Aligned_cols=29  Identities=28%  Similarity=0.488  Sum_probs=26.1

Q ss_pred             eeeeEEEeCCCCcccCHHHHHHHHHHHhc
Q 031081          100 CGIRAIWVTPSNRRKGIASLLLDAVRRSF  128 (166)
Q Consensus       100 ~GI~rIWV~~~~RRkGIAt~Lld~~r~~f  128 (166)
                      .=|..|+|+|++||+|||++||+.+.+..
T Consensus        61 ~~i~~l~V~p~~rg~GiG~~Ll~~~~~~~   89 (128)
T 2k5t_A           61 GALDSLRVREVTRRRGVGQYLLEEVLRNN   89 (128)
T ss_dssp             EEEEEEEECTTCSSSSHHHHHHHHHHHHS
T ss_pred             EEEEEEEECHHHcCCCHHHHHHHHHHHHh
Confidence            34778999999999999999999998876

PyMOL of 2k5t

>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134}	Back alignment and structure

>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0	Back alignment and structure

>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A	Back alignment and structure

>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1	Back alignment and structure

>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A*	Back alignment and structure

>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana}	Back alignment and structure

>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus}	Back alignment and structure

>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A*	Back alignment and structure

>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A}	Back alignment and structure

>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1	Back alignment and structure

>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile}	Back alignment and structure

>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A*	Back alignment and structure

>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A*	Back alignment and structure

>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus}	Back alignment and structure

>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum}	Back alignment and structure

>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A*	Back alignment and structure

>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1}	Back alignment and structure

>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri}	Back alignment and structure

>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1	Back alignment and structure

>1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A*	Back alignment and structure

>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1	Back alignment and structure

>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1	Back alignment and structure

>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp}	Back alignment and structure

>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A	Back alignment and structure

>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A*	Back alignment and structure

>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str}	Back alignment and structure

>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1	Back alignment and structure

>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus}	Back alignment and structure

>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans}	Back alignment and structure

>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1	Back alignment and structure

>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A	Back alignment and structure

>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp}	Back alignment and structure

>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1	Back alignment and structure

>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus}	Back alignment and structure

>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A*	Back alignment and structure

>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A*	Back alignment and structure

>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A	Back alignment and structure

>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1	Back alignment and structure

>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV}	Back alignment and structure

>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli}	Back alignment and structure

>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis}	Back alignment and structure

>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1	Back alignment and structure

>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1	Back alignment and structure

>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A	Back alignment and structure

>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti}	Back alignment and structure

>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1	Back alignment and structure

>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A*	Back alignment and structure

>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str}	Back alignment and structure

>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium}	Back alignment and structure

>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1	Back alignment and structure

>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A*	Back alignment and structure

>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A*	Back alignment and structure

>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus}	Back alignment and structure

>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1	Back alignment and structure

>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1	Back alignment and structure

>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1	Back alignment and structure

>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A*	Back alignment and structure

>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida}	Back alignment and structure

>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp}	Back alignment and structure

>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A*	Back alignment and structure

>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A*	Back alignment and structure

>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1	Back alignment and structure

>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1	Back alignment and structure

>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822}	Back alignment and structure

>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A*	Back alignment and structure

>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A*	Back alignment and structure

>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae}	Back alignment and structure

>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1	Back alignment and structure

>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1}	Back alignment and structure

>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B*	Back alignment and structure

>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP}	Back alignment and structure

>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A*	Back alignment and structure

>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A*	Back alignment and structure

>4b5o_A Alpha-tubulin N-acetyltransferase; microtubules, cilium, intraflagellar transport; HET: ACO; 1.05A {Homo sapiens} PDB: 4b5p_A*	Back alignment and structure

>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1	Back alignment and structure

>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A	Back alignment and structure

>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A*	Back alignment and structure

>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A	Back alignment and structure

>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1	Back alignment and structure

>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa}	Back alignment and structure

>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A*	Back alignment and structure

>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1	Back alignment and structure

>4hkf_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase, MEC-17, GNAT, acetyl-COA, GNAT FO transferase; HET: ACO; 1.70A {Danio rerio} PDB: 4h6u_A* 4h6z_A*	Back alignment and structure

>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1	Back alignment and structure

>4h6u_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase; HET: ACO; 2.45A {Danio rerio} PDB: 4h6z_A*	Back alignment and structure

>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans}	Back alignment and structure

>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi}	Back alignment and structure

>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis}	Back alignment and structure

>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1	Back alignment and structure

>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V}	Back alignment and structure

>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E*	Back alignment and structure

>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0	Back alignment and structure

>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1	Back alignment and structure

>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1}	Back alignment and structure

>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2}	Back alignment and structure

>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1	Back alignment and structure

>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1	Back alignment and structure

>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis}	Back alignment and structure

>4gs4_A Alpha-tubulin N-acetyltransferase; acetyl coenzyme A binding, cytosolic; HET: ACO; 2.11A {Homo sapiens}	Back alignment and structure

>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A*	Back alignment and structure

>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1	Back alignment and structure

>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1	Back alignment and structure

>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum}	Back alignment and structure

>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp}	Back alignment and structure

>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A	Back alignment and structure

>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis}	Back alignment and structure

>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str}	Back alignment and structure

>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1	Back alignment and structure

>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae}	Back alignment and structure

>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0	Back alignment and structure

>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID}	Back alignment and structure

>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A*	Back alignment and structure

>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii}	Back alignment and structure

>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii}	Back alignment and structure

>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1	Back alignment and structure

>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V}	Back alignment and structure

>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus}	Back alignment and structure

>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1	Back alignment and structure

>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A	Back alignment and structure

>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis}	Back alignment and structure

>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1	Back alignment and structure

>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A*	Back alignment and structure

>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa}	Back alignment and structure

>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii}	Back alignment and structure

>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10	Back alignment and structure

>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1	Back alignment and structure

>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10	Back alignment and structure

>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti}	Back alignment and structure

>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A*	Back alignment and structure

>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis}	Back alignment and structure

>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A*	Back alignment and structure

>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A*	Back alignment and structure

>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A	Back alignment and structure

>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A*	Back alignment and structure

>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1	Back alignment and structure

>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus}	Back alignment and structure

>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10	Back alignment and structure

>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228}	Back alignment and structure

>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum}	Back alignment and structure

>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A*	Back alignment and structure

>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea}	Back alignment and structure

>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728}	Back alignment and structure

>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A*	Back alignment and structure

>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A*	Back alignment and structure

>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A*	Back alignment and structure

>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A*	Back alignment and structure

>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5	Back alignment and structure

>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans}	Back alignment and structure

>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12}	Back alignment and structure

>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis}	Back alignment and structure

>3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID}	Back alignment and structure

>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp}	Back alignment and structure

>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium}	Back alignment and structure

>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1	Back alignment and structure

>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		166
d2gana1		182	Hypothetical protein PH0736 {Pyrococcus horikoshii	97.57
d2aj6a1		118	Hypothetical protein MW0638 {Staphylococcus aureus	97.47
d1y9wa1		140	Probable acetyltransferase BC2806 {Bacillus cereus	97.34
d2g3aa1		137	Probable acetyltransferase Atu2258 {Agrobacterium	97.31
d2fiwa1		156	Probable N-acetyltransferase RPA1999 {Rhodopseudom	97.23
d1s3za_		147	Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal	97.19
d1bo4a_		137	Aminoglycoside 3-N-acetyltransferase {Serratia mar	97.1
d1wwza1		157	Hypothetical protein PH1933 {Pyrococcus horikoshii	97.05
d2jdca1		145	Probable acetyltransferase YitI {Bacillus lichenif	97.05
d1z4ea1		150	Transcriptional regulator BH1968 {Bacillus halodur	97.04
d1y7ra1		133	Hypothetical protein SA2161 {Staphylococcus aureus	97.02
d1mk4a_		157	Hypothetical protein YqiY {Bacillus subtilis [TaxI	96.99
d1yx0a1		151	Hypothetical protein YsnE {Bacillus subtilis [TaxI	96.97
d1i12a_		157	Glucosamine-phosphate N-acetyltransferase GNA1 {Ba	96.94
d1m4ia_		181	Aminoglycoside 2'-N-acetyltransferase {Mycobacteri	96.93
d1vkca_		149	Putative acetyltransferase PF0028 {Pyrococcus furi	96.91
d2fl4a1		146	Probable spermine/spermidine acetyltransferase EF1	96.91
d1r57a_		102	Hypothetical protein SA2309 {Staphylococcus aureus	96.89
d2i6ca1		160	Putative acetyltransferase PA4794 {Pseudomonas aer	96.89
d2atra1		137	Probable acetyltransferase SP0256 {Streptococcus p	96.88
d1cjwa_		166	Serotonin N-acetyltranferase {Sheep (Ovis aries) [	96.86
d1n71a_		180	Aminoglycoside 6'-N-acetyltransferase {Enterococcu	96.83
d1yvoa1		169	Hypothetical protein PA4866 {Pseudomonas aeruginos	96.81
d2fiaa1		157	Probable acetyltransferase EF1919 {Enterococcus fa	96.8
d1yr0a1		163	Phosphinothricin acetyltransferase {Agrobacterium	96.77
d1ufha_		155	Putative acetyltransferase YycN {Bacillus subtilis	96.76
d2fe7a1		156	Probable N-acetyltransferase PA0478 {Pseudomonas a	96.75
d1q2ya_		140	Probable acetyltransferase YjcF {Bacillus subtilis	96.75
d2b5ga1		167	Diamine acetyltransferase 1 {Human (Homo sapiens)	96.73
d1y9ka1		152	IAA acetyltransferase {Bacillus cereus [TaxId: 139	96.69
d1u6ma_		189	Putative acetyltransferase EF0945 {Enterococcus fa	96.68
d1ghea_		170	Tabtoxin resistance protein {Pseudomonas syringae	96.64
d2ae6a1		161	Putative acetyltransferase EF0244 {Enterococcus fa	96.62
d1vhsa_		165	Putative phosphinothricin acetyltransferase YwnH {	96.54
d1tiqa_		173	Protease synthase and sporulation negative regulat	96.52
d2beia1		167	Diamine acetyltransferase 2 {Human (Homo sapiens)	96.49
d2cy2a1		174	Probable acetyltransferase TTHA1209 {Thermus therm	96.38
d1qsma_		150	Histone acetyltransferase HPA2 {Baker's yeast (Sac	96.34
d1qsra_		162	Catalytic domain of GCN5 histone acetyltransferase	96.32
d2ge3a1		164	Probable acetyltransferase Atu2290 {Agrobacterium	96.23
d1yvka1		152	Hypothetical protein YvbK (BSu33890) {Bacillus sub	96.21
d1ygha_		164	Catalytic domain of GCN5 histone acetyltransferase	96.15
d2euia1		153	Probable acetyltransferase PA4026 {Pseudomonas aer	96.15
d1p0ha_		308	Mycothiol synthase MshD {Mycobacterium tuberculosi	96.12
d1z4ra1		162	Catalytic domain of GCN5 histone acetyltransferase	96.05
d1xeba_		149	Hypothetical protein PA0115 {Pseudomonas aeruginos	95.69
d1p0ha_		308	Mycothiol synthase MshD {Mycobacterium tuberculosi	95.53
d2i00a2		291	Putative acetyltransferase EF2353 {Enterococcus fa	95.47
d2hv2a2		285	Hypothetical protein EF1021 {Enterococcus faecalis	95.32
d2ozga2		283	Putative acetyltransferase Ava4977 {Anabaena varia	94.93
d1sqha_		297	Hypothetical protein cg14615-pa {Fruit fly (Drosop	94.72
d1xmta_		95	Hypothetical protein AT1g77540 {Thale cress (Arabi	94.09
d1nsla_		180	Probable acetyltransferase YdaF {Bacillus subtilis	93.42
d1s7ka1		174	L7/L12-Ribosomal-protein-serine acetyltransferase	92.92
d1yrea1		183	Hypothetical protein PA3270 {Pseudomonas aeruginos	91.59
d1yk3a1		198	Hypothetical protein Rv1347c/MT1389 {Mycobacterium	91.02
d2fcka1		178	Putative ribosomal-protein-serine acetyltransferas	89.4
d1boba_		315	Histone acetyltransferase HAT1 {Baker's yeast (Sac	82.32

>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Hypothetical protein PH0736
species: Pyrococcus horikoshii [TaxId: 53953]

Probab=97.57  E-value=6.1e-05  Score=55.65  Aligned_cols=34  Identities=29%  Similarity=0.225  Sum_probs=28.2

Q ss_pred             eeeeeEEEeCCCCcccCHHHHHHHHHHHhcc-ccc
Q 031081           99 VCGIRAIWVTPSNRRKGIASLLLDAVRRSFC-GEI  132 (166)
Q Consensus        99 ~~GI~rIWV~~~~RRkGIAt~Lld~~r~~fi-yG~  132 (166)
                      ..-|.+|+|+|++||+|||++||+.+.+..- .|.
T Consensus       106 ~~~I~~l~V~p~~rg~GiG~~Ll~~~~~~ak~~G~  140 (182)
T d2gana1         106 VGLIEFFVVDPEFQGKGIGSTLLEFAVKRLRSLGK  140 (182)
T ss_dssp             EEEEEEEEECTTSTTSSHHHHHHHHHHHHHHHTTC
T ss_pred             EEEEEEEEECHhhcCCCHHHHHHHHHHHHHHHcCC
Confidence            5568899999999999999999998877554 343

PyMOL of d2gana1

>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]}	Back information, alignment and structure

>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]}	Back information, alignment and structure

>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]}	Back information, alignment and structure

>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]}	Back information, alignment and structure

>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]}	Back information, alignment and structure

>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]}	Back information, alignment and structure

>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]}	Back information, alignment and structure

>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]}	Back information, alignment and structure

>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]}	Back information, alignment and structure

>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure