Citrus Sinensis ID: 031081
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 166 | ||||||
| 225428940 | 372 | PREDICTED: N-acetyltransferase ESCO2 [Vi | 1.0 | 0.446 | 0.649 | 2e-57 | |
| 224138338 | 281 | predicted protein [Populus trichocarpa] | 0.993 | 0.587 | 0.635 | 9e-57 | |
| 297735770 | 374 | unnamed protein product [Vitis vinifera] | 1.0 | 0.443 | 0.637 | 7e-56 | |
| 225443353 | 392 | PREDICTED: N-acetyltransferase ESCO2-lik | 1.0 | 0.423 | 0.626 | 3e-55 | |
| 255583582 | 379 | conserved hypothetical protein [Ricinus | 0.993 | 0.435 | 0.595 | 2e-51 | |
| 297802888 | 344 | hypothetical protein ARALYDRAFT_491601 [ | 0.945 | 0.456 | 0.571 | 4e-44 | |
| 449437458 | 361 | PREDICTED: N-acetyltransferase ESCO2-lik | 0.993 | 0.457 | 0.528 | 9e-44 | |
| 145350620 | 345 | N-acetyltransferase [Arabidopsis thalian | 0.951 | 0.457 | 0.568 | 6e-43 | |
| 356572623 | 347 | PREDICTED: N-acetyltransferase ESCO2-lik | 0.939 | 0.449 | 0.529 | 7e-41 | |
| 356572615 | 347 | PREDICTED: N-acetyltransferase ESCO2-lik | 0.939 | 0.449 | 0.523 | 3e-40 |
| >gi|225428940|ref|XP_002263529.1| PREDICTED: N-acetyltransferase ESCO2 [Vitis vinifera] gi|296083078|emb|CBI22482.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 226 bits (576), Expect = 2e-57, Method: Compositional matrix adjust.
Identities = 113/174 (64%), Positives = 132/174 (75%), Gaps = 8/174 (4%)
Query: 1 MEFELGEGWIFQK--------ICQRVAGCLVAEPIKEGFKLLSCFGDERTDGRILKKCRS 52
ME ELG WIF K QRVAGCLVAEPIK+ +K+LS DER++ K+ R
Sbjct: 196 MEIELGGAWIFHKNRKVYLFISSQRVAGCLVAEPIKKAYKILSSSADERSNDTSSKETRP 255
Query: 53 HSATLQFGEISLQREVIKRASSVHSSNAVDEKHNGTIMCENEAVPAVCGIRAIWVTPSNR 112
+S TLQFG +S QREVIKRA SV+S +D + NG ++CENEAVPA+CGIRAIWVTPSNR
Sbjct: 256 NSNTLQFGTVSFQREVIKRAPSVNSCEVLDGRPNGPVVCENEAVPAICGIRAIWVTPSNR 315
Query: 113 RKGIASLLLDAVRRSFCGEIVLEKSQLAFSQPSSAGKALASNYFGTASFLVYRT 166
RK IAS LLDAVR+SFC VL+ SQLAFSQP+SAG ALASNYFG+ SFLVY+T
Sbjct: 316 RKHIASQLLDAVRKSFCMGFVLKSSQLAFSQPTSAGMALASNYFGSGSFLVYKT 369
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224138338|ref|XP_002322789.1| predicted protein [Populus trichocarpa] gi|222867419|gb|EEF04550.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297735770|emb|CBI18457.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225443353|ref|XP_002266283.1| PREDICTED: N-acetyltransferase ESCO2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255583582|ref|XP_002532547.1| conserved hypothetical protein [Ricinus communis] gi|223527736|gb|EEF29841.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297802888|ref|XP_002869328.1| hypothetical protein ARALYDRAFT_491601 [Arabidopsis lyrata subsp. lyrata] gi|297315164|gb|EFH45587.1| hypothetical protein ARALYDRAFT_491601 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449437458|ref|XP_004136509.1| PREDICTED: N-acetyltransferase ESCO2-like [Cucumis sativus] gi|449515408|ref|XP_004164741.1| PREDICTED: N-acetyltransferase ESCO2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|145350620|ref|NP_194868.2| N-acetyltransferase [Arabidopsis thaliana] gi|156254746|gb|ABU62813.1| cohesion establishment factor 7 [Arabidopsis thaliana] gi|332660505|gb|AEE85905.1| N-acetyltransferase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356572623|ref|XP_003554467.1| PREDICTED: N-acetyltransferase ESCO2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356572615|ref|XP_003554463.1| PREDICTED: N-acetyltransferase ESCO2-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 166 | ||||||
| TAIR|locus:2128126 | 345 | CTF7 [Arabidopsis thaliana (ta | 0.945 | 0.455 | 0.571 | 2.5e-42 | |
| UNIPROTKB|F1NGQ2 | 524 | F1NGQ2 "Uncharacterized protei | 0.584 | 0.185 | 0.402 | 7e-17 | |
| UNIPROTKB|Q56NI9 | 601 | ESCO2 "N-acetyltransferase ESC | 0.590 | 0.163 | 0.398 | 8.7e-16 | |
| UNIPROTKB|F1RJS0 | 611 | ESCO2 "Uncharacterized protein | 0.445 | 0.121 | 0.459 | 9e-16 | |
| UNIPROTKB|G3MWW4 | 211 | LOC786089 "Uncharacterized pro | 0.391 | 0.308 | 0.446 | 1.1e-15 | |
| UNIPROTKB|A6QNP8 | 610 | ESCO2 "ESCO2 protein" [Bos tau | 0.445 | 0.121 | 0.445 | 1.9e-15 | |
| UNIPROTKB|J9NWF6 | 598 | ESCO2 "Uncharacterized protein | 0.445 | 0.123 | 0.445 | 2.3e-15 | |
| UNIPROTKB|F1PA26 | 602 | ESCO2 "Uncharacterized protein | 0.445 | 0.122 | 0.445 | 2.3e-15 | |
| RGD|1596873 | 319 | Esco1 "establishment of cohesi | 0.445 | 0.231 | 0.445 | 2.7e-15 | |
| DICTYBASE|DDB_G0279959 | 441 | eco1 "establishment of cohesio | 0.493 | 0.185 | 0.390 | 6.7e-15 |
| TAIR|locus:2128126 CTF7 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 448 (162.8 bits), Expect = 2.5e-42, P = 2.5e-42
Identities = 100/175 (57%), Positives = 121/175 (69%)
Query: 1 MEFELGEGWIFQKIC--------QRVAGCLVAEPIKEGFKLLSCFGDERTDGRILKKCRS 52
ME ELGE WI + C QR++GCLVAEPIKE FKL++ DER ++ K+ S
Sbjct: 170 MEVELGEDWILHQHCKVYLFISSQRISGCLVAEPIKEAFKLIASPDDER---QLQKESSS 226
Query: 53 HSAT-LQFGEISLQREVIKRASSVHSSNAVDEKHNGTIMCENEAVPAVCGIRAIWVTPSN 111
+T +QFG I LQREV KR + S + +D NG I+CE EA PAVCGIRAIWV+PSN
Sbjct: 227 SPSTSIQFGNIVLQREVSKRCRT--SDDRLD---NGVIVCEEEAKPAVCGIRAIWVSPSN 281
Query: 112 RRKGIASLLLDAVRRSFCGE-IVLEKSQLAFSQPSSAGKALASNYFGTASFLVYR 165
RRKGIA+ LLD R SFC +LEKSQLAFSQPSS G++ S YFGT SFL+Y+
Sbjct: 282 RRKGIATWLLDTTRESFCNNGCMLEKSQLAFSQPSSIGRSFGSKYFGTCSFLLYK 336
|
|
| UNIPROTKB|F1NGQ2 F1NGQ2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q56NI9 ESCO2 "N-acetyltransferase ESCO2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RJS0 ESCO2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3MWW4 LOC786089 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QNP8 ESCO2 "ESCO2 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NWF6 ESCO2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PA26 ESCO2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1596873 Esco1 "establishment of cohesion 1 homolog 1 (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0279959 eco1 "establishment of cohesion 1" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 166 | |||
| pfam13880 | 70 | pfam13880, Acetyltransf_13, ESCO1/2 acetyl-transfe | 3e-36 |
| >gnl|CDD|206051 pfam13880, Acetyltransf_13, ESCO1/2 acetyl-transferase | Back alignment and domain information |
|---|
Score = 119 bits (301), Expect = 3e-36
Identities = 43/70 (61%), Positives = 51/70 (72%)
Query: 95 AVPAVCGIRAIWVTPSNRRKGIASLLLDAVRRSFCGEIVLEKSQLAFSQPSSAGKALASN 154
VPA+CGI IWV+PS+RRKGIA+ LLDAVR +F L K Q+AFSQP+ +GKA A
Sbjct: 1 PVPALCGISRIWVSPSHRRKGIATRLLDAVRSNFIYGYELPKEQIAFSQPTESGKAFARK 60
Query: 155 YFGTASFLVY 164
Y GT FLVY
Sbjct: 61 YCGTDDFLVY 70
|
Length = 70 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 166 | |||
| KOG3014 | 257 | consensus Protein involved in establishing cohesio | 100.0 | |
| PF13880 | 70 | Acetyltransf_13: ESCO1/2 acetyl-transferase | 100.0 | |
| PF00583 | 83 | Acetyltransf_1: Acetyltransferase (GNAT) family; I | 97.51 | |
| PF05301 | 120 | Mec-17: Touch receptor neuron protein Mec-17; Inte | 97.21 | |
| PF13673 | 117 | Acetyltransf_10: Acetyltransferase (GNAT) domain; | 97.03 | |
| PHA01807 | 153 | hypothetical protein | 96.74 | |
| PF13508 | 79 | Acetyltransf_7: Acetyltransferase (GNAT) domain; P | 96.74 | |
| TIGR02406 | 157 | ectoine_EctA L-2,4-diaminobutyric acid acetyltrans | 96.7 | |
| PRK10146 | 144 | aminoalkylphosphonic acid N-acetyltransferase; Pro | 96.6 | |
| COG0456 | 177 | RimI Acetyltransferases [General function predicti | 96.49 | |
| PRK03624 | 140 | putative acetyltransferase; Provisional | 96.43 | |
| cd04301 | 65 | NAT_SF N-Acyltransferase superfamily: Various enzy | 96.4 | |
| PHA00673 | 154 | acetyltransferase domain containing protein | 96.34 | |
| PF08445 | 86 | FR47: FR47-like protein; InterPro: IPR013653 Prote | 96.28 | |
| PRK10514 | 145 | putative acetyltransferase; Provisional | 96.22 | |
| COG0454 | 156 | WecD Histone acetyltransferase HPA2 and related ac | 96.22 | |
| TIGR01575 | 131 | rimI ribosomal-protein-alanine acetyltransferase. | 96.19 | |
| PF13527 | 127 | Acetyltransf_9: Acetyltransferase (GNAT) domain; P | 96.18 | |
| PTZ00330 | 147 | acetyltransferase; Provisional | 96.18 | |
| PLN02706 | 150 | glucosamine 6-phosphate N-acetyltransferase | 96.16 | |
| PRK09831 | 147 | putative acyltransferase; Provisional | 96.14 | |
| PRK13688 | 156 | hypothetical protein; Provisional | 96.1 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 96.04 | |
| PRK10314 | 153 | putative acyltransferase; Provisional | 96.03 | |
| PRK07757 | 152 | acetyltransferase; Provisional | 95.93 | |
| PRK10140 | 162 | putative acetyltransferase YhhY; Provisional | 95.83 | |
| PF14542 | 78 | Acetyltransf_CG: GCN5-related N-acetyl-transferase | 95.66 | |
| COG3393 | 268 | Predicted acetyltransferase [General function pred | 95.54 | |
| PRK10562 | 145 | putative acetyltransferase; Provisional | 95.4 | |
| PRK07922 | 169 | N-acetylglutamate synthase; Validated | 95.32 | |
| KOG3139 | 165 | consensus N-acetyltransferase [General function pr | 95.25 | |
| PRK01346 | 411 | hypothetical protein; Provisional | 95.02 | |
| TIGR03827 | 266 | GNAT_ablB putative beta-lysine N-acetyltransferase | 95.02 | |
| PRK09491 | 146 | rimI ribosomal-protein-alanine N-acetyltransferase | 94.81 | |
| PRK10809 | 194 | ribosomal-protein-S5-alanine N-acetyltransferase; | 94.51 | |
| KOG4601 | 264 | consensus Uncharacterized conserved protein [Funct | 94.4 | |
| cd02169 | 297 | Citrate_lyase_ligase Citrate lyase ligase. Citrate | 94.21 | |
| PF13718 | 196 | GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z | 93.78 | |
| TIGR02382 | 191 | wecD_rffC TDP-D-fucosamine acetyltransferase. This | 93.4 | |
| PRK15130 | 186 | spermidine N1-acetyltransferase; Provisional | 93.36 | |
| PF13523 | 152 | Acetyltransf_8: Acetyltransferase (GNAT) domain; P | 93.2 | |
| PRK12308 | 614 | bifunctional argininosuccinate lyase/N-acetylgluta | 93.09 | |
| PRK10975 | 194 | TDP-fucosamine acetyltransferase; Provisional | 93.08 | |
| KOG3216 | 163 | consensus Diamine acetyltransferase [Amino acid tr | 92.96 | |
| PRK05279 | 441 | N-acetylglutamate synthase; Validated | 92.93 | |
| TIGR03103 | 547 | trio_acet_GNAT GNAT-family acetyltransferase TIGR0 | 92.36 | |
| TIGR03448 | 292 | mycothiol_MshD mycothiol biosynthesis acetyltransf | 92.24 | |
| TIGR01890 | 429 | N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi | 92.19 | |
| PF13302 | 142 | Acetyltransf_3: Acetyltransferase (GNAT) domain; P | 91.69 | |
| PF13420 | 155 | Acetyltransf_4: Acetyltransferase (GNAT) domain; P | 90.63 | |
| PRK10151 | 179 | ribosomal-protein-L7/L12-serine acetyltransferase; | 90.54 | |
| COG1247 | 169 | Sortase and related acyltransferases [Cell envelop | 90.19 | |
| PLN02825 | 515 | amino-acid N-acetyltransferase | 89.92 | |
| TIGR00124 | 332 | cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP | 89.6 | |
| COG1444 | 758 | Predicted P-loop ATPase fused to an acetyltransfer | 89.41 | |
| COG2388 | 99 | Predicted acetyltransferase [General function pred | 89.04 | |
| TIGR03585 | 156 | PseH pseudaminic acid biosynthesis N-acetyl transf | 87.21 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 86.96 | |
| PF12568 | 128 | DUF3749: Acetyltransferase (GNAT) domain; InterPro | 83.79 | |
| KOG2488 | 202 | consensus Acetyltransferase (GNAT) domain-containi | 83.56 | |
| COG1670 | 187 | RimL Acetyltransferases, including N-acetylases of | 82.37 | |
| KOG3138 | 187 | consensus Predicted N-acetyltransferase [General f | 81.88 | |
| KOG3235 | 193 | consensus Subunit of the major N alpha-acetyltrans | 81.78 |
| >KOG3014 consensus Protein involved in establishing cohesion between sister chromatids during DNA replication [Replication, recombination and repair] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.3e-40 Score=280.33 Aligned_cols=125 Identities=42% Similarity=0.687 Sum_probs=111.8
Q ss_pred CccccCCcccccc---cC---------ceeeEEEeeeeccccccccccCCCCCCcccccccccCCCcccccchhhHHHHH
Q 031081 1 MEFELGEGWIFQK---IC---------QRVAGCLVAEPIKEGFKLLSCFGDERTDGRILKKCRSHSATLQFGEISLQREV 68 (166)
Q Consensus 1 ~e~Elg~~wil~~---~~---------~rVvGClvAE~I~~A~rvi~~~~~~~~~~~~~~e~~~~s~tl~fg~i~~~rev 68 (166)
|+.|||..|+.++ .+ +.||||||||||++||+++..+.. .+
T Consensus 113 VnnELg~~~~~~~~~~~~k~~lFIS~rk~~VGcLvaE~Is~a~~~i~~~~~--~~------------------------- 165 (257)
T KOG3014|consen 113 VNNELGYQQIENQCWPKIKTFLFISVRKIVVGCLVAEPISQAFRVIESPGV--TD------------------------- 165 (257)
T ss_pred HHhhcCCcccccccccceeEEEEEEecceeeeEEEehhhhhhhhhccCcCc--cc-------------------------
Confidence 6889999999998 43 557999999999999999986641 00
Q ss_pred HHhhcccCCCccccccCCCeeEeecceeceeeeeeEEEeCCCCcccCHHHHHHHHHHHhccccccccCCceeecCCChhH
Q 031081 69 IKRASSVHSSNAVDEKHNGTIMCENEAVPAVCGIRAIWVTPSNRRKGIASLLLDAVRRSFCGEIVLEKSQLAFSQPSSAG 148 (166)
Q Consensus 69 ~~~~~~~~~~~~~~~~~~~~~~cs~~p~pa~~GI~rIWV~~~~RRkGIAt~Lld~~r~~fiyG~~l~~~eiAFSqPT~~G 148 (166)
+.+.+.+|+||+.|.|++|||+||||++..||+|||++|||+|+++|+||+.+++.+|||||||++|
T Consensus 166 -------------~~~s~~~~~~s~~~~~~~~GIsRIWV~s~~Rr~gIAs~lldva~~~~~~g~~isr~~iAfs~PTddG 232 (257)
T KOG3014|consen 166 -------------SYDSQKAWQNSPLPEPAICGISRIWVSSLRRRKGIASLLLDVARCNFVYGEVISREEIAFSDPTDDG 232 (257)
T ss_pred -------------chhhHHHhccCCCCCCcEeeeEEEEeehhhhhhhhHHHHHHHHHHhhhhhcccchhheEecCCCchh
Confidence 0112367899999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhhCCCceEeec
Q 031081 149 KALASNYFGTASFLVYR 165 (166)
Q Consensus 149 ~~fA~~y~~~~~flVY~ 165 (166)
++||++|+|+.+|++|+
T Consensus 233 k~lAt~~~~t~~~~~~~ 249 (257)
T KOG3014|consen 233 KKLATKYCGTRNFLTYN 249 (257)
T ss_pred HHHHHHHhCccchhhhh
Confidence 99999999999999986
|
|
| >PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase | Back alignment and domain information |
|---|
| >PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 | Back alignment and domain information |
|---|
| >PF05301 Mec-17: Touch receptor neuron protein Mec-17; InterPro: IPR007965 Mec-17 is the protein product of one of the 18 genes required for the development and function of the touch receptor neuron for gentle touch | Back alignment and domain information |
|---|
| >PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A | Back alignment and domain information |
|---|
| >PHA01807 hypothetical protein | Back alignment and domain information |
|---|
| >PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A | Back alignment and domain information |
|---|
| >TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase | Back alignment and domain information |
|---|
| >PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0456 RimI Acetyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03624 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate | Back alignment and domain information |
|---|
| >PHA00673 acetyltransferase domain containing protein | Back alignment and domain information |
|---|
| >PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK10514 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01575 rimI ribosomal-protein-alanine acetyltransferase | Back alignment and domain information |
|---|
| >PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B | Back alignment and domain information |
|---|
| >PTZ00330 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02706 glucosamine 6-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK09831 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13688 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >PRK10314 putative acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07757 acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10140 putative acetyltransferase YhhY; Provisional | Back alignment and domain information |
|---|
| >PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A | Back alignment and domain information |
|---|
| >COG3393 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10562 putative acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07922 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >KOG3139 consensus N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01346 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG4601 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd02169 Citrate_lyase_ligase Citrate lyase ligase | Back alignment and domain information |
|---|
| >PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B | Back alignment and domain information |
|---|
| >TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase | Back alignment and domain information |
|---|
| >PRK15130 spermidine N1-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A | Back alignment and domain information |
|---|
| >PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK10975 TDP-fucosamine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3216 consensus Diamine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05279 N-acetylglutamate synthase; Validated | Back alignment and domain information |
|---|
| >TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 | Back alignment and domain information |
|---|
| >TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase | Back alignment and domain information |
|---|
| >TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A | Back alignment and domain information |
|---|
| >PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A | Back alignment and domain information |
|---|
| >PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02825 amino-acid N-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase | Back alignment and domain information |
|---|
| >COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2388 Predicted acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length | Back alignment and domain information |
|---|
| >KOG2488 consensus Acetyltransferase (GNAT) domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3138 consensus Predicted N-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3235 consensus Subunit of the major N alpha-acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 166 | |||
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 6e-04 | |
| 3ey5_A | 181 | Acetyltransferase-like, GNAT family; structural ge | 9e-04 |
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Length = 153 | Back alignment and structure |
|---|
Score = 37.5 bits (87), Expect = 6e-04
Identities = 10/43 (23%), Positives = 19/43 (44%), Gaps = 4/43 (9%)
Query: 102 IRAIWVTPSNRRKGIASLLLDAV----RRSFCGEIVLEKSQLA 140
I ++V PS+R +GI L++ VL +++
Sbjct: 90 ILNLYVDPSHRERGIGQALMNRAEAEFAERGIAFAVLHATEMG 132
|
| >3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Length = 181 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 166 | |||
| 2k5t_A | 128 | Uncharacterized protein YHHK; N-acetyl transferase | 97.52 | |
| 2q0y_A | 153 | GCN5-related N-acetyltransferase; YP_295895.1, ace | 97.49 | |
| 3fnc_A | 163 | Protein LIN0611, putative acetyltransferase; GNAT, | 97.45 | |
| 1qsm_A | 152 | HPA2 histone acetyltransferase; protein-acetyl coe | 97.4 | |
| 1z4e_A | 153 | Transcriptional regulator; nysgxrc target T2017, G | 97.3 | |
| 3gy9_A | 150 | GCN5-related N-acetyltransferase; YP_001815201.1, | 97.27 | |
| 3t90_A | 149 | Glucose-6-phosphate acetyltransferase 1; GNAT fold | 97.22 | |
| 3e0k_A | 150 | Amino-acid acetyltransferase; N-acetylglutamate sy | 97.21 | |
| 1r57_A | 102 | Conserved hypothetical protein; GCN5, N-acetyltran | 97.19 | |
| 2pdo_A | 144 | Acetyltransferase YPEA; alpha-beta-alpha sandwich, | 97.18 | |
| 2atr_A | 138 | Acetyltransferase, GNAT family; MCSG, structural g | 97.17 | |
| 3dsb_A | 157 | Putative acetyltransferase; APC60368.2, ST genomic | 97.15 | |
| 4e0a_A | 164 | BH1408 protein; structural genomics, PSI-biology, | 97.15 | |
| 4ag7_A | 165 | Glucosamine-6-phosphate N-acetyltransferase; HET: | 97.14 | |
| 3exn_A | 160 | Probable acetyltransferase; GCN5-related N-acetylt | 97.14 | |
| 3mgd_A | 157 | Predicted acetyltransferase; structural genomics, | 97.12 | |
| 2bei_A | 170 | Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 | 97.12 | |
| 3efa_A | 147 | Putative acetyltransferase; structural genom 2, pr | 97.11 | |
| 3jvn_A | 166 | Acetyltransferase; alpha-beta protein, structural | 97.1 | |
| 1wwz_A | 159 | Hypothetical protein PH1933; structural genomics, | 97.1 | |
| 1xmt_A | 103 | Putative acetyltransferase; structural genomics, p | 97.1 | |
| 3ey5_A | 181 | Acetyltransferase-like, GNAT family; structural ge | 97.09 | |
| 2fe7_A | 166 | Probable N-acetyltransferase; structural genomics, | 97.08 | |
| 2fia_A | 162 | Acetyltransferase; structural genomics, PSI, prote | 97.08 | |
| 3lod_A | 162 | Putative acyl-COA N-acyltransferase; structural ge | 97.07 | |
| 1cjw_A | 166 | Protein (serotonin N-acetyltransferase); HET: COT; | 97.07 | |
| 2i6c_A | 160 | Putative acetyltransferase; GNAT family, structura | 97.07 | |
| 2oh1_A | 179 | Acetyltransferase, GNAT family; YP_013287.1, struc | 97.06 | |
| 1y9w_A | 140 | Acetyltransferase; structural genomics, Pro struct | 97.05 | |
| 3t9y_A | 150 | Acetyltransferase, GNAT family; PSI-biology, struc | 97.05 | |
| 2qec_A | 204 | Histone acetyltransferase HPA2 and related acetylt | 97.04 | |
| 3s6f_A | 145 | Hypothetical acetyltransferase; acyl-COA N-acyltra | 97.03 | |
| 1tiq_A | 180 | Protease synthase and sporulation negative regulat | 97.03 | |
| 3i3g_A | 161 | N-acetyltransferase; malaria, structural genomics, | 97.02 | |
| 3d8p_A | 163 | Acetyltransferase of GNAT family; NP_373092.1, str | 97.02 | |
| 1u6m_A | 199 | Acetyltransferase, GNAT family; structural genomic | 97.01 | |
| 3bln_A | 143 | Acetyltransferase GNAT family; NP_981174.1, struct | 97.0 | |
| 2jdc_A | 146 | Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. | 96.99 | |
| 1qst_A | 160 | TGCN5 histone acetyl transferase; GCN5-related N-a | 96.97 | |
| 4evy_A | 166 | Aminoglycoside N(6')-acetyltransferase type 1; cen | 96.95 | |
| 1bo4_A | 168 | Protein (serratia marcescens aminoglycoside-3-N- a | 96.95 | |
| 2ozh_A | 142 | Hypothetical protein XCC2953; structural genomics, | 96.94 | |
| 2kcw_A | 147 | Uncharacterized acetyltransferase YJAB; GNAT fold, | 96.94 | |
| 2pr1_A | 163 | Uncharacterized N-acetyltransferase YLBP; YIBP pro | 96.93 | |
| 2eui_A | 153 | Probable acetyltransferase; dimer, structural geno | 96.93 | |
| 2g3a_A | 152 | Acetyltransferase; structural genomics, PSI, prote | 96.93 | |
| 1i12_A | 160 | Glucosamine-phosphate N-acetyltransferase; GNAT, a | 96.93 | |
| 4fd4_A | 217 | Arylalkylamine N-acetyltransferase like 5B; GNAT; | 96.92 | |
| 1y7r_A | 133 | Hypothetical protein SA2161; structural genomics, | 96.92 | |
| 1ghe_A | 177 | Acetyltransferase; acyl coenzyme A complex; HET: A | 96.91 | |
| 2dxq_A | 150 | AGR_C_4057P, acetyltransferase; structural genomic | 96.91 | |
| 3fyn_A | 176 | Integron gene cassette protein HFX_CASS3; integron | 96.91 | |
| 1q2y_A | 140 | Protein YJCF, similar to hypothetical proteins; GC | 96.9 | |
| 2cy2_A | 174 | TTHA1209, probable acetyltransferase; structural g | 96.9 | |
| 3dr6_A | 174 | YNCA; acetyltransferase, csgid target, essential g | 96.89 | |
| 2x7b_A | 168 | N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf | 96.88 | |
| 2fiw_A | 172 | GCN5-related N-acetyltransferase:aminotransferase | 96.87 | |
| 1xeb_A | 150 | Hypothetical protein PA0115; midwest center for st | 96.87 | |
| 1ufh_A | 180 | YYCN protein; alpha and beta, fold, acetyltransfer | 96.87 | |
| 1n71_A | 180 | AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, | 96.87 | |
| 4h89_A | 173 | GCN5-related N-acetyltransferase; N-acyltransferas | 96.86 | |
| 2r7h_A | 177 | Putative D-alanine N-acetyltransferase of GNAT FA; | 96.85 | |
| 1m4i_A | 181 | Aminoglycoside 2'-N-acetyltransferase; COA binding | 96.84 | |
| 1s3z_A | 165 | Aminoglycoside 6'-N-acetyltransferase; GNAT, amino | 96.84 | |
| 1yr0_A | 175 | AGR_C_1654P, phosphinothricin acetyltransferase; s | 96.83 | |
| 2aj6_A | 159 | Hypothetical protein MW0638; structural genomics, | 96.83 | |
| 3d3s_A | 189 | L-2,4-diaminobutyric acid acetyltransferase; alpha | 96.82 | |
| 2cnt_A | 160 | Modification of 30S ribosomal subunit protein S18; | 96.81 | |
| 2b5g_A | 171 | Diamine acetyltransferase 1; structural genomics, | 96.81 | |
| 3i9s_A | 183 | Integron cassette protein; oyster POND, woods HOLE | 96.79 | |
| 1ygh_A | 164 | ADA4, protein (transcriptional activator GCN5); tr | 96.78 | |
| 3kkw_A | 182 | Putative uncharacterized protein; acetyltransferas | 96.78 | |
| 1z4r_A | 168 | General control of amino acid synthesis protein 5- | 96.77 | |
| 2r1i_A | 172 | GCN5-related N-acetyltransferase; YP_831484.1, put | 96.74 | |
| 2ob0_A | 170 | Human MAK3 homolog; acetyltransferase, structural | 96.73 | |
| 3fix_A | 183 | N-acetyltransferase; termoplasma acidophilum, stru | 96.73 | |
| 4b5o_A | 200 | Alpha-tubulin N-acetyltransferase; microtubules, c | 96.73 | |
| 1vkc_A | 158 | Putative acetyl transferase; structural genomics, | 96.7 | |
| 2o28_A | 184 | Glucosamine 6-phosphate N-acetyltransferase; struc | 96.7 | |
| 2vez_A | 190 | Putative glucosamine 6-phosphate acetyltransferase | 96.69 | |
| 2j8m_A | 172 | Acetyltransferase PA4866 from P. aeruginosa; GCN5 | 96.69 | |
| 1mk4_A | 157 | Hypothetical protein YQJY; alpha-beta-alpha sandwi | 96.68 | |
| 3owc_A | 188 | Probable acetyltransferase; structural genomics, P | 96.67 | |
| 2ree_A | 224 | CURA; GNAT, S-acetyltransferase, decarboxylase, po | 96.67 | |
| 2ae6_A | 166 | Acetyltransferase, GNAT family; GCN5-related N-ace | 96.67 | |
| 4hkf_A | 191 | Alpha-tubulin N-acetyltransferase; tubulin acetylt | 96.66 | |
| 1y9k_A | 157 | IAA acetyltransferase; structural genomics, midwes | 96.65 | |
| 4h6u_A | 200 | Alpha-tubulin N-acetyltransferase; tubulin acetylt | 96.64 | |
| 3ld2_A | 197 | SMU.2055, putative acetyltransferase; HET: COA; 2. | 96.61 | |
| 2jlm_A | 182 | Putative phosphinothricin N-acetyltransferase; met | 96.6 | |
| 3pp9_A | 187 | Putative streptothricin acetyltransferase; toxin p | 96.59 | |
| 2fl4_A | 149 | Spermine/spermidine acetyltransferase; structural | 96.58 | |
| 2pc1_A | 201 | Acetyltransferase, GNAT family; NP_688560.1, struc | 96.57 | |
| 1kux_A | 207 | Aralkylamine, serotonin N-acetyltransferase; enzym | 96.56 | |
| 3igr_A | 184 | Ribosomal-protein-S5-alanine N-acetyltransferase; | 96.52 | |
| 1on0_A | 158 | YYCN protein; structural genomics, alpha-beta prot | 96.52 | |
| 3qb8_A | 197 | A654L protein; GNAT N-acetyltransferase, acetyltra | 96.5 | |
| 3f8k_A | 160 | Protein acetyltransferase; GCN5-related N-acetyltr | 96.48 | |
| 2gan_A | 190 | 182AA long hypothetical protein; alpha-beta protei | 96.46 | |
| 2ge3_A | 170 | Probable acetyltransferase; structural GEN PSI, pr | 96.45 | |
| 3frm_A | 254 | Uncharacterized conserved protein; APC61048, staph | 96.38 | |
| 4gs4_A | 240 | Alpha-tubulin N-acetyltransferase; acetyl coenzyme | 96.37 | |
| 2bue_A | 202 | AAC(6')-IB; GNAT, transferase, aminoglycoside, flu | 96.36 | |
| 1yvk_A | 163 | Hypothetical protein BSU33890; ALPHS-beta protein, | 96.36 | |
| 1vhs_A | 175 | Similar to phosphinothricin acetyltransferase; str | 96.35 | |
| 2q04_A | 211 | Acetoin utilization protein; ZP_00540088.1, struct | 96.35 | |
| 3f5b_A | 182 | Aminoglycoside N(6')acetyltransferase; APC60744, l | 96.35 | |
| 4fd5_A | 222 | Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A | 96.33 | |
| 3juw_A | 175 | Probable GNAT-family acetyltransferase; structural | 96.3 | |
| 3fbu_A | 168 | Acetyltransferase, GNAT family; structur genomics, | 96.29 | |
| 1yx0_A | 159 | Hypothetical protein YSNE; NESG, GFT structral gen | 96.28 | |
| 2i79_A | 172 | Acetyltransferase, GNAT family; acetyl coenzyme *A | 96.26 | |
| 3eg7_A | 176 | Spermidine N1-acetyltransferase; structural genomi | 96.25 | |
| 3ec4_A | 228 | Putative acetyltransferase from the GNAT family; Y | 96.25 | |
| 3te4_A | 215 | GH12636P, dopamine N acetyltransferase, isoform A; | 96.24 | |
| 3tth_A | 170 | Spermidine N1-acetyltransferase; central intermedi | 96.21 | |
| 3eo4_A | 164 | Uncharacterized protein MJ1062; APC60792.2,MJ_1062 | 96.18 | |
| 1nsl_A | 184 | Probable acetyltransferase; structural genomics, h | 96.12 | |
| 2q7b_A | 181 | Acetyltransferase, GNAT family; NP_689019.1, struc | 96.0 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 95.93 | |
| 1yre_A | 197 | Hypothetical protein PA3270; APC5563, midwest cent | 95.81 | |
| 1s7k_A | 182 | Acetyl transferase; GNAT; 1.80A {Salmonella typhim | 95.77 | |
| 3n7z_A | 388 | Acetyltransferase, GNAT family; PSI2, MCSG, struct | 95.76 | |
| 1bob_A | 320 | HAT1, histone acetyltransferase; histone modificat | 95.74 | |
| 3r9f_A | 188 | MCCE protein; microcin C7, acetyltransferase, SELF | 95.67 | |
| 2vi7_A | 177 | Acetyltransferase PA1377; GNAT, GCN5 family, N-ace | 95.66 | |
| 3ddd_A | 288 | Putative acetyltransferase; NP_142035.1, structura | 95.63 | |
| 2i00_A | 406 | Acetyltransferase, GNAT family; structural genomic | 95.59 | |
| 2fsr_A | 195 | Acetyltransferase; alpha-beta-sandwich, structural | 95.57 | |
| 2hv2_A | 400 | Hypothetical protein; PSI, protein structure initi | 95.56 | |
| 4fd7_A | 238 | Putative arylalkylamine N-acetyltransferase 7; GNA | 95.55 | |
| 2vzy_A | 218 | RV0802C; transferase, GCN5-related N-acetyltransfe | 95.55 | |
| 3sxn_A | 422 | Enhanced intracellular surviVal protein; GNAT fold | 95.52 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 95.5 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 95.45 | |
| 3r1k_A | 428 | Enhanced intracellular surviVal protein; GNAT, ace | 95.44 | |
| 2wpx_A | 339 | ORF14; transferase, acetyl transferase, antibiotic | 95.4 | |
| 2fck_A | 181 | Ribosomal-protein-serine acetyltransferase, putat; | 95.26 | |
| 3tt2_A | 330 | GCN5-related N-acetyltransferase; structural genom | 95.21 | |
| 2ozg_A | 396 | GCN5-related N-acetyltransferase; YP_325469.1, ace | 95.16 | |
| 3g8w_A | 169 | Lactococcal prophage PS3 protein 05; APC61042, ace | 95.14 | |
| 3pzj_A | 209 | Probable acetyltransferases; MCSG, PSI-2, structur | 95.12 | |
| 2zw5_A | 301 | Bleomycin acetyltransferase; dimer, two domains; H | 94.93 | |
| 3iwg_A | 276 | Acetyltransferase, GNAT family; structural genomic | 94.86 | |
| 3c26_A | 266 | Putative acetyltransferase TA0821; NP_394282.1, A | 94.84 | |
| 3d2m_A | 456 | Putative acetylglutamate synthase; protein-COA-Glu | 94.78 | |
| 4ava_A | 333 | Lysine acetyltransferase; allosteric regulation, d | 94.72 | |
| 2z10_A | 194 | Ribosomal-protein-alanine acetyltransferase; alpha | 94.46 | |
| 1p0h_A | 318 | Hypothetical protein RV0819; GNAT fold, acetyltran | 94.4 | |
| 1sqh_A | 312 | Hypothetical protein CG14615-PA; structural genomi | 94.38 | |
| 2qml_A | 198 | BH2621 protein; structural genomics, joint center | 94.22 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 94.18 | |
| 3g3s_A | 249 | GCN5-related N-acetyltransferase; ZP_00874857.1, a | 93.83 | |
| 3tcv_A | 246 | GCN5-related N-acetyltransferase; GRAM negative co | 93.66 | |
| 3h4q_A | 188 | Putative acetyltransferase; NP_371943.1, structura | 92.71 | |
| 2g0b_A | 198 | FEEM; N-acyl transferase, environmental DNA, prote | 92.56 | |
| 1yk3_A | 210 | Hypothetical protein RV1347C/MT1389; acyltransfera | 91.78 | |
| 2p0w_A | 324 | Histone acetyltransferase type B catalytic subuni; | 87.45 |
| >2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} | Back alignment and structure |
|---|
Probab=97.52 E-value=7.1e-05 Score=53.09 Aligned_cols=29 Identities=28% Similarity=0.488 Sum_probs=26.1
Q ss_pred eeeeEEEeCCCCcccCHHHHHHHHHHHhc
Q 031081 100 CGIRAIWVTPSNRRKGIASLLLDAVRRSF 128 (166)
Q Consensus 100 ~GI~rIWV~~~~RRkGIAt~Lld~~r~~f 128 (166)
.=|..|+|+|++||+|||++||+.+.+..
T Consensus 61 ~~i~~l~V~p~~rg~GiG~~Ll~~~~~~~ 89 (128)
T 2k5t_A 61 GALDSLRVREVTRRRGVGQYLLEEVLRNN 89 (128)
T ss_dssp EEEEEEEECTTCSSSSHHHHHHHHHHHHS
T ss_pred EEEEEEEECHHHcCCCHHHHHHHHHHHHh
Confidence 34778999999999999999999998876
|
| >2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A | Back alignment and structure |
|---|
| >1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* | Back alignment and structure |
|---|
| >3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* | Back alignment and structure |
|---|
| >2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} | Back alignment and structure |
|---|
| >4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* | Back alignment and structure |
|---|
| >4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* | Back alignment and structure |
|---|
| >3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* | Back alignment and structure |
|---|
| >3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} | Back alignment and structure |
|---|
| >1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* | Back alignment and structure |
|---|
| >3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A | Back alignment and structure |
|---|
| >2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* | Back alignment and structure |
|---|
| >2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A | Back alignment and structure |
|---|
| >3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} | Back alignment and structure |
|---|
| >2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* | Back alignment and structure |
|---|
| >1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* | Back alignment and structure |
|---|
| >4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A | Back alignment and structure |
|---|
| >1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A | Back alignment and structure |
|---|
| >4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} | Back alignment and structure |
|---|
| >1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* | Back alignment and structure |
|---|
| >2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} | Back alignment and structure |
|---|
| >1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* | Back alignment and structure |
|---|
| >3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* | Back alignment and structure |
|---|
| >2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* | Back alignment and structure |
|---|
| >4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} | Back alignment and structure |
|---|
| >2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* | Back alignment and structure |
|---|
| >1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* | Back alignment and structure |
|---|
| >1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* | Back alignment and structure |
|---|
| >2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* | Back alignment and structure |
|---|
| >3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* | Back alignment and structure |
|---|
| >2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} | Back alignment and structure |
|---|
| >2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* | Back alignment and structure |
|---|
| >3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* | Back alignment and structure |
|---|
| >4b5o_A Alpha-tubulin N-acetyltransferase; microtubules, cilium, intraflagellar transport; HET: ACO; 1.05A {Homo sapiens} PDB: 4b5p_A* | Back alignment and structure |
|---|
| >1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A | Back alignment and structure |
|---|
| >2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* | Back alignment and structure |
|---|
| >2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A | Back alignment and structure |
|---|
| >1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* | Back alignment and structure |
|---|
| >2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >4hkf_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase, MEC-17, GNAT, acetyl-COA, GNAT FO transferase; HET: ACO; 1.70A {Danio rerio} PDB: 4h6u_A* 4h6z_A* | Back alignment and structure |
|---|
| >1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >4h6u_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase; HET: ACO; 2.45A {Danio rerio} PDB: 4h6z_A* | Back alignment and structure |
|---|
| >3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} | Back alignment and structure |
|---|
| >3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* | Back alignment and structure |
|---|
| >3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} | Back alignment and structure |
|---|
| >3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >4gs4_A Alpha-tubulin N-acetyltransferase; acetyl coenzyme A binding, cytosolic; HET: ACO; 2.11A {Homo sapiens} | Back alignment and structure |
|---|
| >2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* | Back alignment and structure |
|---|
| >1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A | Back alignment and structure |
|---|
| >3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 | Back alignment and structure |
|---|
| >3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* | Back alignment and structure |
|---|
| >3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A | Back alignment and structure |
|---|
| >3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* | Back alignment and structure |
|---|
| >2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} | Back alignment and structure |
|---|
| >2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* | Back alignment and structure |
|---|
| >3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A | Back alignment and structure |
|---|
| >2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* | Back alignment and structure |
|---|
| >2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 | Back alignment and structure |
|---|
| >3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* | Back alignment and structure |
|---|
| >3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* | Back alignment and structure |
|---|
| >4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* | Back alignment and structure |
|---|
| >2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* | Back alignment and structure |
|---|
| >1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* | Back alignment and structure |
|---|
| >1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 | Back alignment and structure |
|---|
| >2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} | Back alignment and structure |
|---|
| >3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} | Back alignment and structure |
|---|
| >1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 | Back alignment and structure |
|---|
| >2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 166 | |||
| d2gana1 | 182 | Hypothetical protein PH0736 {Pyrococcus horikoshii | 97.57 | |
| d2aj6a1 | 118 | Hypothetical protein MW0638 {Staphylococcus aureus | 97.47 | |
| d1y9wa1 | 140 | Probable acetyltransferase BC2806 {Bacillus cereus | 97.34 | |
| d2g3aa1 | 137 | Probable acetyltransferase Atu2258 {Agrobacterium | 97.31 | |
| d2fiwa1 | 156 | Probable N-acetyltransferase RPA1999 {Rhodopseudom | 97.23 | |
| d1s3za_ | 147 | Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal | 97.19 | |
| d1bo4a_ | 137 | Aminoglycoside 3-N-acetyltransferase {Serratia mar | 97.1 | |
| d1wwza1 | 157 | Hypothetical protein PH1933 {Pyrococcus horikoshii | 97.05 | |
| d2jdca1 | 145 | Probable acetyltransferase YitI {Bacillus lichenif | 97.05 | |
| d1z4ea1 | 150 | Transcriptional regulator BH1968 {Bacillus halodur | 97.04 | |
| d1y7ra1 | 133 | Hypothetical protein SA2161 {Staphylococcus aureus | 97.02 | |
| d1mk4a_ | 157 | Hypothetical protein YqiY {Bacillus subtilis [TaxI | 96.99 | |
| d1yx0a1 | 151 | Hypothetical protein YsnE {Bacillus subtilis [TaxI | 96.97 | |
| d1i12a_ | 157 | Glucosamine-phosphate N-acetyltransferase GNA1 {Ba | 96.94 | |
| d1m4ia_ | 181 | Aminoglycoside 2'-N-acetyltransferase {Mycobacteri | 96.93 | |
| d1vkca_ | 149 | Putative acetyltransferase PF0028 {Pyrococcus furi | 96.91 | |
| d2fl4a1 | 146 | Probable spermine/spermidine acetyltransferase EF1 | 96.91 | |
| d1r57a_ | 102 | Hypothetical protein SA2309 {Staphylococcus aureus | 96.89 | |
| d2i6ca1 | 160 | Putative acetyltransferase PA4794 {Pseudomonas aer | 96.89 | |
| d2atra1 | 137 | Probable acetyltransferase SP0256 {Streptococcus p | 96.88 | |
| d1cjwa_ | 166 | Serotonin N-acetyltranferase {Sheep (Ovis aries) [ | 96.86 | |
| d1n71a_ | 180 | Aminoglycoside 6'-N-acetyltransferase {Enterococcu | 96.83 | |
| d1yvoa1 | 169 | Hypothetical protein PA4866 {Pseudomonas aeruginos | 96.81 | |
| d2fiaa1 | 157 | Probable acetyltransferase EF1919 {Enterococcus fa | 96.8 | |
| d1yr0a1 | 163 | Phosphinothricin acetyltransferase {Agrobacterium | 96.77 | |
| d1ufha_ | 155 | Putative acetyltransferase YycN {Bacillus subtilis | 96.76 | |
| d2fe7a1 | 156 | Probable N-acetyltransferase PA0478 {Pseudomonas a | 96.75 | |
| d1q2ya_ | 140 | Probable acetyltransferase YjcF {Bacillus subtilis | 96.75 | |
| d2b5ga1 | 167 | Diamine acetyltransferase 1 {Human (Homo sapiens) | 96.73 | |
| d1y9ka1 | 152 | IAA acetyltransferase {Bacillus cereus [TaxId: 139 | 96.69 | |
| d1u6ma_ | 189 | Putative acetyltransferase EF0945 {Enterococcus fa | 96.68 | |
| d1ghea_ | 170 | Tabtoxin resistance protein {Pseudomonas syringae | 96.64 | |
| d2ae6a1 | 161 | Putative acetyltransferase EF0244 {Enterococcus fa | 96.62 | |
| d1vhsa_ | 165 | Putative phosphinothricin acetyltransferase YwnH { | 96.54 | |
| d1tiqa_ | 173 | Protease synthase and sporulation negative regulat | 96.52 | |
| d2beia1 | 167 | Diamine acetyltransferase 2 {Human (Homo sapiens) | 96.49 | |
| d2cy2a1 | 174 | Probable acetyltransferase TTHA1209 {Thermus therm | 96.38 | |
| d1qsma_ | 150 | Histone acetyltransferase HPA2 {Baker's yeast (Sac | 96.34 | |
| d1qsra_ | 162 | Catalytic domain of GCN5 histone acetyltransferase | 96.32 | |
| d2ge3a1 | 164 | Probable acetyltransferase Atu2290 {Agrobacterium | 96.23 | |
| d1yvka1 | 152 | Hypothetical protein YvbK (BSu33890) {Bacillus sub | 96.21 | |
| d1ygha_ | 164 | Catalytic domain of GCN5 histone acetyltransferase | 96.15 | |
| d2euia1 | 153 | Probable acetyltransferase PA4026 {Pseudomonas aer | 96.15 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 96.12 | |
| d1z4ra1 | 162 | Catalytic domain of GCN5 histone acetyltransferase | 96.05 | |
| d1xeba_ | 149 | Hypothetical protein PA0115 {Pseudomonas aeruginos | 95.69 | |
| d1p0ha_ | 308 | Mycothiol synthase MshD {Mycobacterium tuberculosi | 95.53 | |
| d2i00a2 | 291 | Putative acetyltransferase EF2353 {Enterococcus fa | 95.47 | |
| d2hv2a2 | 285 | Hypothetical protein EF1021 {Enterococcus faecalis | 95.32 | |
| d2ozga2 | 283 | Putative acetyltransferase Ava4977 {Anabaena varia | 94.93 | |
| d1sqha_ | 297 | Hypothetical protein cg14615-pa {Fruit fly (Drosop | 94.72 | |
| d1xmta_ | 95 | Hypothetical protein AT1g77540 {Thale cress (Arabi | 94.09 | |
| d1nsla_ | 180 | Probable acetyltransferase YdaF {Bacillus subtilis | 93.42 | |
| d1s7ka1 | 174 | L7/L12-Ribosomal-protein-serine acetyltransferase | 92.92 | |
| d1yrea1 | 183 | Hypothetical protein PA3270 {Pseudomonas aeruginos | 91.59 | |
| d1yk3a1 | 198 | Hypothetical protein Rv1347c/MT1389 {Mycobacterium | 91.02 | |
| d2fcka1 | 178 | Putative ribosomal-protein-serine acetyltransferas | 89.4 | |
| d1boba_ | 315 | Histone acetyltransferase HAT1 {Baker's yeast (Sac | 82.32 |
| >d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Acyl-CoA N-acyltransferases (Nat) superfamily: Acyl-CoA N-acyltransferases (Nat) family: N-acetyl transferase, NAT domain: Hypothetical protein PH0736 species: Pyrococcus horikoshii [TaxId: 53953]
Probab=97.57 E-value=6.1e-05 Score=55.65 Aligned_cols=34 Identities=29% Similarity=0.225 Sum_probs=28.2
Q ss_pred eeeeeEEEeCCCCcccCHHHHHHHHHHHhcc-ccc
Q 031081 99 VCGIRAIWVTPSNRRKGIASLLLDAVRRSFC-GEI 132 (166)
Q Consensus 99 ~~GI~rIWV~~~~RRkGIAt~Lld~~r~~fi-yG~ 132 (166)
..-|.+|+|+|++||+|||++||+.+.+..- .|.
T Consensus 106 ~~~I~~l~V~p~~rg~GiG~~Ll~~~~~~ak~~G~ 140 (182)
T d2gana1 106 VGLIEFFVVDPEFQGKGIGSTLLEFAVKRLRSLGK 140 (182)
T ss_dssp EEEEEEEEECTTSTTSSHHHHHHHHHHHHHHHTTC
T ss_pred EEEEEEEEECHhhcCCCHHHHHHHHHHHHHHHcCC
Confidence 5568899999999999999999998877554 343
|
| >d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} | Back information, alignment and structure |
|---|
| >d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} | Back information, alignment and structure |
|---|
| >d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|