Citrus Sinensis ID: 031135


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-----
MNVEKLMKMAGAVRTGGKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDDVVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELVAGETFEAAAEEKTEKPDAAS
ccHHHHHHHHHcccccccccccCEEccccccccccHHHHHHHHHHccccccccccEEEEECccCEEEEEcccEEEEccccEEEEEccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHcccccccccc
*NVEKLMKMAGAVRT*G*GS*RR***A******TDDKRLQSTLKRIGVNAIPAIEEVNIFKDDVVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLD*****************************EVPELVAGETFEA*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVEKLMKMAGAVRTGGKGSVRRKKKAVHKTTTTDDKRLQSTLKRIGVNAIPAIEEVNIFKDDVVIQFLNPKVQASIAANTWVVSGAPQTKKLQDILPGIINQLGPDNLDNLRKLAEQFQKQAPNAGTGAPTTQEDDDDEVPELVAGETFEAAAEEKTEKPDAAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nascent polypeptide-associated complex subunit beta Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting (By similarity). The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum (By similarity). EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.probableA2R091
Nascent polypeptide-associated complex subunit beta Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting (By similarity). The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum (By similarity). EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.probableQ92371
Nascent polypeptide-associated complex subunit beta Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting (By similarity). The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum (By similarity). EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II.probableA7F9B8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LKX, chain A
Confidence level:very confident
Coverage over the Query: 48-112
View the alignment between query and template
View the model in PyMOL