Citrus Sinensis ID: 031159

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----

MIRLTLTLVLVIGILSSTSQSLRFEIQSAHTKCIAEDIKSNSMTVGKYNVVNPNDGHPLPESHKLTVRVTSAYGNSYHYADRVDSGQFAFTAAEAGDYMACFWAVDHSPQTTVTIDFDWRTGVQAKDWSNVAKKGSVDVMELELKKLYDTVSSIHQEMFYLRER

cHHHHHHHHHHHHHHHHcEEEEEEEEEcccccEEEEEcccccEEEEEEEEEccccccccccccEEEEEEEcccccEEEEEECccccEEEEEEEEcccEEEEEEEcccccccEEEEEEEEECcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcc

**RLTLTLVLVIGILSSTSQSLRFEIQSAHTKCIAEDIKSNSMTVGKYNVVNPNDGHPLPESHKLTVRVTSAYGNSYHYADRVDSGQFAFTAAEAGDYMACFWAVDHSPQTTVTIDFDWRTGVQAKDWSNVAKKGSVDVMELELKKLYDTVSSIHQEMFYLRE*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MIRLTLTLVLVIGILSSTSQSLRFEIQSAHTKCIAEDIKSNSMTVGKYNVVNPNDGHPLPESHKLTVRVTSAYGNSYHYADRVDSGQFAFTAAEAGDYMACFWAVDHSPQTTVTIDFDWRTGVQAKDWSNVAKKGSVDVMELELKKLYDTVSSIHQEMFYLRER

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transmembrane emp24 domain-containing protein p24delta9	Involved in vesicular protein trafficking. Mainly functions in the early secretory pathway. Thought to act as cargo receptor at the lumenal side for incorporation of secretory cargo molecules into transport vesicles and to be involved in vesicle coat formation at the cytoplasmic side.	probable	Q9LQY3

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OLM, chain A
Confidence level:probable
Coverage over the Query: 23-53,64-123
View the alignment between query and template
View the model in PyMOL