Citrus Sinensis ID: 031160

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MNLVSRRDLIGLVLGVSTLILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVSLFILAKSSRKMIDFCTWYYFIVMGAFCYSVCASLVLLVLSMLLFCLLSVSS
cccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccEEcccccEEEEEEEccccccccccEEEEEEEEEcccccEEcccccccccEEEEccccEEEEEEEHHcccccccccEEEEEEEccccccccccccccccccEEEEEEEEEEc
****S*RDLIGLVLGVSTLILDSFDAK*******************ELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVSLFILAKSSRKMIDFCTWYYFIVMGAFCYSVCASLVLLVLSMLLFCLLSVSS
xxxxxHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLVSRRDLIGLVLGVSTLILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVSLFILAKSSRKMIDFCTWYYFIVMGAFCYSVCASLVLLVLSMLLFCLLSVSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.probableO22870

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3JXV, chain A
Confidence level:very confident
Coverage over the Query: 71-163
View the alignment between query and template
View the model in PyMOL