Citrus Sinensis ID: 031160

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MNLVSRRDLIGLVLGVSTLILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVSLFILAKSSRKMIDFCTWYYFIVMGAFCYSVCASLVLLVLSMLLFCLLSVSS
cccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccEEcccccEEEEEEEccccccccccEEEEEEEEEcccccEEcccccccccEEEEccccEEEEEEEHHcccccccccEEEEEEEccccccccccccccccccEEEEEEEEEEc
cccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccEEcccccEEEEEEEccccccccccEEEEEEEEEEccccEEcccccccccEEEEccccEEccHHHHHHHEEcccccEEEEEEEccHHHccccccccEcHccEEEEEEEEccc
MNLVSRRDLIGLVLGVSTLIldsfdakgaglppeekprlcddACEKelenvpmvttesglqykdikvgqgpsppvgFQVAANYVamipsgqifdsslekgrpyifrvgsgQVSLFILAKSSRKMIDFCTWYYFIVMGAFCYSVCASLVLLVLSMLLFCLLSVSS
MNLVSRRDLIGLVLGVSTLILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVSLFILAKSSRKMIDFCTWYYFIVMGAFCYSVCASLVLLVLSMLLFCLLSVSS
MNLVSRRDLIGLVLGVSTLILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVSLFILAKSSRKMIDFCTWYYFIVMGAFCYsvcaslvllvlsmllfcllsvss
******RDLIGLVLGVSTLILDSFDAK*************************MVT***GLQYKDIKVG****PPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVSLFILAKSSRKMIDFCTWYYFIVMGAFCYSVCASLVLLVLSMLLFCLLS***
****S**DLIGLVLGVSTL***************************ELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVSLFILAKSSRKMIDFCTWYYFIVMGAFCYSVCASLVLLVLSMLLFCLLSVSS
MNLVSRRDLIGLVLGVSTLILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVSLFILAKSSRKMIDFCTWYYFIVMGAFCYSVCASLVLLVLSMLLFCLLSVSS
*NLVSRRDLIGLVLGVSTLILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVSLFILAKSSRKMIDFCTWYYFIVMGAFCYSVCASLVLLVLSMLLFCLLSV**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLVSRRDLIGLVLGVSTLILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVSLFILAKSSRKMIDFCTWYYFIVMGAFCYSVCASLVLLVLSMLLFCLLSVSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query164 2.2.26 [Sep-21-2011]
O22870223 Peptidyl-prolyl cis-trans yes no 0.676 0.497 0.803 2e-45
Q54NB6364 FK506-binding protein 4 O yes no 0.402 0.181 0.441 2e-08
Q6C4C9407 FK506-binding protein 3 O yes no 0.335 0.135 0.446 9e-07
Q554J3107 FK506-binding protein 1 O no no 0.329 0.504 0.407 1e-06
Q9SCY2208 Peptidyl-prolyl cis-trans no no 0.402 0.317 0.378 2e-06
P51752230 Peptidyl-prolyl cis-trans yes no 0.371 0.265 0.419 3e-06
Q4WMV5489 FK506-binding protein 4 O yes no 0.329 0.110 0.363 9e-06
Q2UN37470 FK506-binding protein 4 O yes no 0.329 0.114 0.363 1e-05
P0C1B0479 FK506-binding protein 4 O no no 0.463 0.158 0.358 2e-05
P44760241 Probable FKBP-type peptid yes no 0.323 0.219 0.396 5e-05
>sp|O22870|FK163_ARATH Peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic OS=Arabidopsis thaliana GN=FKBP16-3 PE=1 SV=2 Back     alignment and function desciption
 Score =  181 bits (459), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 98/112 (87%), Gaps = 1/112 (0%)

Query: 2   NLVSRRDLIGLVLGVST-LILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGL 60
           NL SRR+ + LVLGVS  L + S  A  AGLPPE+KPRLC+  CEKELENVPMVTTESGL
Sbjct: 49  NLSSRREAMLLVLGVSGGLSMSSLAAYAAGLPPEDKPRLCEAECEKELENVPMVTTESGL 108

Query: 61  QYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQV 112
           QYKDIKVG+GPSPPVGFQVAANYVAM+PSGQIFDSSLEKG PY+FRVGSGQV
Sbjct: 109 QYKDIKVGRGPSPPVGFQVAANYVAMVPSGQIFDSSLEKGLPYLFRVGSGQV 160
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q54NB6|FKBP4_DICDI FK506-binding protein 4 OS=Dictyostelium discoideum GN=fkbp4 PE=1 SV=1 Back     alignment and function description
>sp|Q6C4C9|FKBP3_YARLI FK506-binding protein 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FPR3 PE=3 SV=1 Back     alignment and function description
>sp|Q554J3|FKBP1_DICDI FK506-binding protein 1 OS=Dictyostelium discoideum GN=fkbp1 PE=3 SV=1 Back     alignment and function description
>sp|Q9SCY2|FKB13_ARATH Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic OS=Arabidopsis thaliana GN=FKBP13 PE=1 SV=2 Back     alignment and function description
>sp|P51752|MIP_COXBU Peptidyl-prolyl cis-trans isomerase Mip OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=mip PE=1 SV=2 Back     alignment and function description
>sp|Q4WMV5|FKBP4_ASPFU FK506-binding protein 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fpr4 PE=3 SV=2 Back     alignment and function description
>sp|Q2UN37|FKBP4_ASPOR FK506-binding protein 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=fpr4 PE=3 SV=1 Back     alignment and function description
>sp|P0C1B0|FKBP4_EMENI FK506-binding protein 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=fpr4 PE=3 SV=2 Back     alignment and function description
>sp|P44760|FKBY_HAEIN Probable FKBP-type peptidyl-prolyl cis-trans isomerase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0574 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
359478215231 PREDICTED: probable FKBP-type peptidyl-p 0.670 0.476 0.854 7e-50
356538867232 PREDICTED: probable FKBP-type peptidyl-p 0.676 0.478 0.837 8e-49
357473089226 hypothetical protein MTR_4g068190 [Medic 0.676 0.491 0.857 1e-48
388500658229 unknown [Medicago truncatula] 0.676 0.484 0.857 2e-48
217073500239 unknown [Medicago truncatula] 0.786 0.539 0.738 7e-48
217072022229 unknown [Medicago truncatula] 0.676 0.484 0.848 8e-48
449468858227 PREDICTED: peptidyl-prolyl cis-trans iso 0.676 0.488 0.801 1e-47
388514693238 unknown [Medicago truncatula] 0.676 0.466 0.848 1e-47
255637694232 unknown [Glycine max] 0.670 0.474 0.827 2e-47
356545409232 PREDICTED: probable FKBP-type peptidyl-p 0.676 0.478 0.830 2e-47
>gi|359478215|ref|XP_002274062.2| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 2, chloroplastic-like [Vitis vinifera] gi|296084250|emb|CBI24638.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  201 bits (511), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 105/110 (95%)

Query: 3   LVSRRDLIGLVLGVSTLILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGLQY 62
           ++ RR+ IGLVLGVS++ +DSFDAK AGLPPE+KPRLCDDACEKELENVPMVTTESGLQY
Sbjct: 59  MLKRREAIGLVLGVSSIFVDSFDAKAAGLPPEDKPRLCDDACEKELENVPMVTTESGLQY 118

Query: 63  KDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQV 112
           KDIKVG+GPSPP+GFQVAANYVAM+PSGQIFDSSLEKG+ YIFRVGSGQV
Sbjct: 119 KDIKVGEGPSPPIGFQVAANYVAMVPSGQIFDSSLEKGQLYIFRVGSGQV 168

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356538867|ref|XP_003537922.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 2, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|357473089|ref|XP_003606829.1| hypothetical protein MTR_4g068190 [Medicago truncatula] gi|355507884|gb|AES89026.1| hypothetical protein MTR_4g068190 [Medicago truncatula] Back     alignment and taxonomy information
>gi|388500658|gb|AFK38395.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|217073500|gb|ACJ85110.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|217072022|gb|ACJ84371.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449468858|ref|XP_004152138.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic-like [Cucumis sativus] gi|449484749|ref|XP_004156969.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388514693|gb|AFK45408.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255637694|gb|ACU19170.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356545409|ref|XP_003541135.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 2, chloroplastic-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
TAIR|locus:2058218223 AT2G43560 "AT2G43560" [Arabido 0.676 0.497 0.803 1.2e-42
UNIPROTKB|Q6ZIT9261 OJ1211_G06.16 "Peptidyl-prolyl 0.652 0.409 0.774 2.5e-42
UNIPROTKB|A8IW09208 FKB16-3 "Peptidyl-prolyl cis-t 0.530 0.418 0.551 1.3e-22
UNIPROTKB|P73037201 ytfC "Peptidyl-prolyl cis-tran 0.609 0.497 0.381 6.4e-12
UNIPROTKB|A8J3L4194 FKB16-2a "Peptidyl-prolyl cis- 0.365 0.309 0.433 1.5e-10
UNIPROTKB|Q74AS7156 GSU2274 "Peptidyl-prolyl cis-t 0.573 0.602 0.336 2e-10
TIGR_CMR|GSU_2274156 GSU_2274 "FKBP-type peptidyl-p 0.573 0.602 0.336 2e-10
DICTYBASE|DDB_G0285357364 DDB_G0285357 "FKBP-type peptid 0.402 0.181 0.441 1.6e-09
UNIPROTKB|Q7NMC5161 glr0841 "Peptidyl-prolyl cis-t 0.353 0.360 0.465 1.8e-09
UNIPROTKB|A9WGZ8237 Caur_0860 "Peptidyl-prolyl cis 0.353 0.244 0.431 2e-09
TAIR|locus:2058218 AT2G43560 "AT2G43560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 451 (163.8 bits), Expect = 1.2e-42, P = 1.2e-42
 Identities = 90/112 (80%), Positives = 98/112 (87%)

Query:     2 NLVSRRDLIGLVLGVST-LILDSFDAKGAGLPPEEKPRLCDDACEKELENVPMVTTESGL 60
             NL SRR+ + LVLGVS  L + S  A  AGLPPE+KPRLC+  CEKELENVPMVTTESGL
Sbjct:    49 NLSSRREAMLLVLGVSGGLSMSSLAAYAAGLPPEDKPRLCEAECEKELENVPMVTTESGL 108

Query:    61 QYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQV 112
             QYKDIKVG+GPSPPVGFQVAANYVAM+PSGQIFDSSLEKG PY+FRVGSGQV
Sbjct:   109 QYKDIKVGRGPSPPVGFQVAANYVAMVPSGQIFDSSLEKGLPYLFRVGSGQV 160
GO:0000413 "protein peptidyl-prolyl isomerization" evidence=IBA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IBA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0006457 "protein folding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009543 "chloroplast thylakoid lumen" evidence=ISS;IDA
GO:0016020 "membrane" evidence=IBA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0031977 "thylakoid lumen" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006364 "rRNA processing" evidence=RCA
GO:0009657 "plastid organization" evidence=RCA
GO:0010027 "thylakoid membrane organization" evidence=RCA
GO:0010207 "photosystem II assembly" evidence=RCA
GO:0015979 "photosynthesis" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019684 "photosynthesis, light reaction" evidence=RCA
UNIPROTKB|Q6ZIT9 OJ1211_G06.16 "Peptidyl-prolyl cis-trans isomerase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|A8IW09 FKB16-3 "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|P73037 ytfC "Peptidyl-prolyl cis-trans isomerase" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
UNIPROTKB|A8J3L4 FKB16-2a "Peptidyl-prolyl cis-trans isomerase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
UNIPROTKB|Q74AS7 GSU2274 "Peptidyl-prolyl cis-trans isomerase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2274 GSU_2274 "FKBP-type peptidyl-prolyl cis-trans isomerase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285357 DDB_G0285357 "FKBP-type peptidylprolyl cis-trans isomerase (PPIase)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q7NMC5 glr0841 "Peptidyl-prolyl cis-trans isomerase" [Gloeobacter violaceus PCC 7421 (taxid:251221)] Back     alignment and assigned GO terms
UNIPROTKB|A9WGZ8 Caur_0860 "Peptidyl-prolyl cis-trans isomerase" [Chloroflexus aurantiacus J-10-fl (taxid:324602)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O22870FK163_ARATH5, ., 2, ., 1, ., 80.80350.67680.4977yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00034616001
RecName- Full=Peptidyl-prolyl cis-trans isomerase; EC=5.2.1.8; (231 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 8e-15
PRK11570206 PRK11570, PRK11570, peptidyl-prolyl cis-trans isom 1e-07
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 4e-07
PRK10902269 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis- 1e-06
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 68.2 bits (167), Expect = 8e-15
 Identities = 23/57 (40%), Positives = 33/57 (57%)

Query: 52  PMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVG 108
            + T  SGLQYK +K G G +P  G  V  +Y   +  G +FDSS ++G+P  F +G
Sbjct: 95  GVKTLPSGLQYKVLKAGDGAAPKKGDTVTVHYTGTLIDGTVFDSSYDRGQPAEFPLG 151

Length = 205
>gnl|CDD|183207 PRK11570, PRK11570, peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
>gnl|CDD|236791 PRK10902, PRK10902, FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 164
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.96
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.92
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.92
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.9
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.89
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.88
KOG0549188 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.87
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.76
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.64
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.43
PRK10737 196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.39
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.2
KOG0543 397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.0
TIGR00115 408 tig trigger factor. Trigger factor is a ribosome-a 98.53
KOG0545 329 consensus Aryl-hydrocarbon receptor-interacting pr 98.45
PRK01490 435 tig trigger factor; Provisional 98.43
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 98.43
KOG0549 188 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.31
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.96  E-value=8.5e-30  Score=197.37  Aligned_cols=114  Identities=29%  Similarity=0.315  Sum_probs=102.7

Q ss_pred             hhhhcCCCceecCCCcEEEEEEcCCCCCCCCCCEEEEEEEEEcCCCCEEecccCCCcCEEEEECCCchhhhhhHhHhCCC
Q 031160           45 EKELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVSLFILAKSSRKM  124 (164)
Q Consensus        45 ~~~~~~~~~~~~~~Gl~~~~l~~G~G~~p~~Gd~V~v~Y~~~~~dG~vfdss~~~~~p~~f~lG~g~vi~Gl~eg~L~~m  124 (164)
                      +++.....++++++||+|++++.|+|..|+.||+|++||++++.||++||||+++++|+.|.+|  ++|+||++| |++|
T Consensus        88 ~~~~k~~~v~~~~sgl~y~~~~~G~G~~~~~~~~V~vhY~G~l~~G~vFDsS~~rg~p~~f~l~--~vI~Gw~eg-l~~M  164 (205)
T COG0545          88 EKNAKEKGVKTLPSGLQYKVLKAGDGAAPKKGDTVTVHYTGTLIDGTVFDSSYDRGQPAEFPLG--GVIPGWDEG-LQGM  164 (205)
T ss_pred             hhhcccCCceECCCCcEEEEEeccCCCCCCCCCEEEEEEEEecCCCCccccccccCCCceeecC--CeeehHHHH-HhhC
Confidence            3444457788999999999999999999999999999999999999999999999999999998  999999996 9999


Q ss_pred             CCCeEEEEEecCCCcccc-cCCCcccchhhHHHHhhhhc
Q 031160          125 IDFCTWYYFIVMGAFCYS-VCASLVLLVLSMLLFCLLSV  162 (164)
Q Consensus       125 k~Ge~~~~~IP~~~~~~~-~~~~~~~~~~~~~~~~~~~~  162 (164)
                      ++|++|+++||+++ +|| ....+.+|+.|+|+|+.=|+
T Consensus       165 ~vG~k~~l~IP~~l-aYG~~g~~g~Ippns~LvFeVeLl  202 (205)
T COG0545         165 KVGGKRKLTIPPEL-AYGERGVPGVIPPNSTLVFEVELL  202 (205)
T ss_pred             CCCceEEEEeCchh-ccCcCCCCCCCCCCCeEEEEEEEE
Confidence            99999999999996 777 44467799999999986443

>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
3vaw_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-08
3uf8_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-08
4ggq_C209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-08
3uqa_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 3e-08
4dz3_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 5e-08
4dz2_A113 Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Is 8e-08
2y78_A133 Crystal Structure Of Bpss1823, A Mip-Like Chaperone 9e-08
2ke0_A117 Solution Structure Of Peptidyl-Prolyl Cis-Trans Iso 1e-07
3uqb_A209 Crystal Structure Of A Smt Fusion Peptidyl-Prolyl C 2e-07
1u79_A129 Crystal Structure Of Atfkbp13 Length = 129 3e-07
1kt1_A 457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 9e-05
1kt0_A 457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 2e-04
1fd9_A213 Crystal Structure Of The Macrophage Infectivity Pot 2e-04
2uz5_A137 Solution Structure Of The Fkbp-Domain Of Legionella 2e-04
3o5e_A144 Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 3e-04
3o5d_A 264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 3e-04
4drh_A144 Co-crystal Structure Of The Ppiase Domain Of Fkbp51 3e-04
3o5l_A128 Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Le 4e-04
3o5g_A128 Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 4e-04
2ki3_A126 Structural And Biochemical Characterization Of Fk50 7e-04
>pdb|3VAW|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation V3i From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure 
Iteration: 1

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 3/83 (3%)
Query: 33  PEEKPRLCDDACEKELENV---PMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPS 89
           PE+     +D  E   E +    +VTTESGL+Y+D+  G G     G  V+ +Y   +  
Sbjct: 76  PEDLDMEDNDIIEAHREQIGGSTIVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTD 135
Query: 90  GQIFDSSLEKGRPYIFRVGSGQV 112
           GQ FDSS ++  P+ F +G G V
Sbjct: 136 GQKFDSSKDRNDPFAFVLGGGMV 158
>pdb|3UF8|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With A G95a Surface Mutation From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4GGQ|C Chain C, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Complexed With Cj40 Length = 209 Back     alignment and structure
>pdb|3UQA|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation A54e From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|4DZ3|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation M61h From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|4DZ2|A Chain A, Crystal Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation R92g From Burkholderia Pseudomallei Complexed With Fk506 Length = 113 Back     alignment and structure
>pdb|2Y78|A Chain A, Crystal Structure Of Bpss1823, A Mip-Like Chaperone From Burkholderia Pseudomallei Length = 133 Back     alignment and structure
>pdb|2KE0|A Chain A, Solution Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 117 Back     alignment and structure
>pdb|3UQB|A Chain A, Crystal Structure Of A Smt Fusion Peptidyl-Prolyl Cis-Trans Isomerase With Surface Mutation D44g From Burkholderia Pseudomallei Complexed With Fk506 Length = 209 Back     alignment and structure
>pdb|1U79|A Chain A, Crystal Structure Of Atfkbp13 Length = 129 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1FD9|A Chain A, Crystal Structure Of The Macrophage Infectivity Potentiator Protein (Mip) A Major Virulence Factor From Legionella Pneumophila Length = 213 Back     alignment and structure
>pdb|2UZ5|A Chain A, Solution Structure Of The Fkbp-Domain Of Legionella Pneumophila Mip Length = 137 Back     alignment and structure
>pdb|3O5E|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form Vi Length = 144 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|4DRH|A Chain A, Co-crystal Structure Of The Ppiase Domain Of Fkbp51, Rapamycin And The Frb Fragment Of Mtor At Low Ph Length = 144 Back     alignment and structure
>pdb|3O5L|A Chain A, Fk1 Domain Mutant A19t Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|3O5G|A Chain A, Fk1 Domain Of Fkbp51, Crystal Form I Length = 128 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 4e-22
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 5e-21
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 3e-20
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 5e-18
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 2e-17
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 4e-17
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 6e-17
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 7e-17
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 1e-16
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 4e-16
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 2e-15
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 3e-05
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 5e-04
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 3e-15
1fd9_A213 Protein (macrophage infectivity potentiator prote; 5e-15
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 1e-14
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 1e-14
1jvw_A167 Macrophage infectivity potentiator; chagas disease 1e-14
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 4e-14
2ppn_A107 FK506-binding protein 1A; high resolution protein 6e-14
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 2e-13
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 9e-13
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 1e-11
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 2e-10
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 4e-10
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 5e-10
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 2e-09
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-08
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 4e-04
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
 Score = 84.7 bits (210), Expect = 4e-22
 Identities = 25/66 (37%), Positives = 38/66 (57%)

Query: 47  ELENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFR 106
           E  +     + SGL + D  VG GP    G  + A+YV  + +G++FDSS  +G+P  FR
Sbjct: 1   ETTSCEFSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFR 60

Query: 107 VGSGQV 112
           +G G+V
Sbjct: 61  IGVGEV 66
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Length = 224 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Length = 169 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.91
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.91
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.91
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.91
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.91
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.91
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.91
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.91
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.9
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.9
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.9
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.9
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.9
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.9
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.9
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.89
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.89
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.89
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.89
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.89
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.86
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.85
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.84
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.83
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.82
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.82
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.81
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.79
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.67
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.66
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.65
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.65
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.64
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.63
3prb_A 231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.61
2kfw_A 196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.59
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.59
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.56
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.45
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 99.18
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.1
1t11_A 392 Trigger factor, TF; helix-turn-helix, four-helix-b 99.0
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 97.71
3cg8_A 343 Laccase; oxidoreductase, multicopper blue protein; 84.95
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
Probab=99.91  E-value=1e-24  Score=159.81  Aligned_cols=110  Identities=28%  Similarity=0.353  Sum_probs=98.9

Q ss_pred             CCCceecCCCcEEEEEEcCCCCCCCCCCEEEEEEEEEcCCCCEEecccCCCcCEEEEECCCchhhhhhHhHhCCCCCCeE
Q 031160           50 NVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVSLFILAKSSRKMIDFCT  129 (164)
Q Consensus        50 ~~~~~~~~~Gl~~~~l~~G~G~~p~~Gd~V~v~Y~~~~~dG~vfdss~~~~~p~~f~lG~g~vi~Gl~eg~L~~mk~Ge~  129 (164)
                      ..++.++++|++|+++++|+|..|+.||.|++||++++.||++||+++++++|+.|.+|.+++|+||+++ |.+|++||+
T Consensus        20 ~~~~~~~~~gl~~~~l~~G~G~~~~~gd~V~v~Y~g~~~dG~~fdss~~~~~p~~f~lG~g~vi~G~eea-L~gmk~Ge~   98 (133)
T 2y78_A           20 HMTVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGMVIKGWDEG-VQGMKVGGV   98 (133)
T ss_dssp             TTCCEECTTSCEEEEEECCSSCBCCTTSEEEEEEEEEETTSCEEEETTTTTCCEEEETTSSSSCHHHHHH-STTCBTTCE
T ss_pred             CCCcEECCCCEEEEEEEcCCCCCCCCCCEEEEEEEEEECCCCEEeccCcCCCCEEEEeCCCChhHHHHHH-HcCCCCCCE
Confidence            3557789999999999999999999999999999999989999999998789999999999999999995 999999999


Q ss_pred             EEEEecCCCcccccCCC-cccchhhHHHHhhhh
Q 031160          130 WYYFIVMGAFCYSVCAS-LVLLVLSMLLFCLLS  161 (164)
Q Consensus       130 ~~~~IP~~~~~~~~~~~-~~~~~~~~~~~~~~~  161 (164)
                      ++++||+++ +||.... ..+|+.++|+|++=+
T Consensus        99 ~~v~ip~~~-aYG~~~~~~~Ipp~~~l~f~VeL  130 (133)
T 2y78_A           99 RRLTIPPQL-GYGARGAGGVIPPNATLVFEVEL  130 (133)
T ss_dssp             EEEEECGGG-TTTTTCBTTTBCTTCCEEEEEEE
T ss_pred             EEEEECcHH-hCCCCCCCCCCCCCCeEEEEEEE
Confidence            999999985 7774433 479999999997543
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 164
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 4e-10
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 3e-07
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 3e-07
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 7e-07
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 7e-07
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 4e-05
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 6e-05
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 7e-04
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 0.001
d1ix5a_151 d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcu 0.003
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP13
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 52.6 bits (125), Expect = 4e-10
 Identities = 24/60 (40%), Positives = 36/60 (60%)

Query: 53  MVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQV 112
              + SGL + D  VG GP    G  + A+YV  + +G++FDSS  +G+P  FR+G G+V
Sbjct: 3   FSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLENGKVFDSSYNRGKPLTFRIGVGEV 62
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.94
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.93
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.93
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.93
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.93
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.93
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.93
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.92
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.9
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.82
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.77
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.58
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.33
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 98.67
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 98.64
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: Peptidyl-prolyl cis-trans isomerase FkpA
species: Escherichia coli [TaxId: 562]

Probab=99.94  E-value=1.9e-27  Score=184.64  Aligned_cols=111  Identities=22%  Similarity=0.262  Sum_probs=101.1

Q ss_pred             hcCCCceecCCCcEEEEEEcCCCCCCCCCCEEEEEEEEEcCCCCEEecccCCCcCEEEEECCCchhhhhhHhHhCCCCCC
Q 031160           48 LENVPMVTTESGLQYKDIKVGQGPSPPVGFQVAANYVAMIPSGQIFDSSLEKGRPYIFRVGSGQVSLFILAKSSRKMIDF  127 (164)
Q Consensus        48 ~~~~~~~~~~~Gl~~~~l~~G~G~~p~~Gd~V~v~Y~~~~~dG~vfdss~~~~~p~~f~lG~g~vi~Gl~eg~L~~mk~G  127 (164)
                      ....+++++++||+|+++++|+|+.|..||.|++||++++.||++||+|+++++|+.|.+|  ++|+||+++ |..|++|
T Consensus        97 ~~~~~v~~~~sGl~y~v~~~G~G~~p~~gd~v~v~y~g~l~dG~~fd~s~~~~~p~~~~~~--~vi~g~~e~-l~~m~~G  173 (210)
T d1q6ha_          97 AKEKGVKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTLIDGKEFDNSYTRGEPLSFRLD--GVIPGWTEG-LKNIKKG  173 (210)
T ss_dssp             HHSTTEEECTTSCEEEEEECCSSCCCCTTCEEEEEEEEEETTSCEEEEGGGGTSCEEEEGG--GSCHHHHHH-GGGSCTT
T ss_pred             cccCceEEccCceEEEEeeCCCCCCCCCCceEEEEEEEEEcCCCEEeecccCCCcceeccC--ccchhHHHH-HhhccCC
Confidence            4457788999999999999999999999999999999999999999999999999999996  799999995 9999999


Q ss_pred             eEEEEEecCCCcccccCCCcccchhhHHHHhhhhc
Q 031160          128 CTWYYFIVMGAFCYSVCASLVLLVLSMLLFCLLSV  162 (164)
Q Consensus       128 e~~~~~IP~~~~~~~~~~~~~~~~~~~~~~~~~~~  162 (164)
                      ++|+++|||++ +||..+...+|+.|+|+|++=++
T Consensus       174 ~k~~~~iP~~l-aYG~~g~~~Ippns~Lvfevel~  207 (210)
T d1q6ha_         174 GKIKLVIPPEL-AYGKAGVPGIPPNSTLVFDVELL  207 (210)
T ss_dssp             CEEEEEECGGG-TTTTTCBTTBCTTCCEEEEEEEE
T ss_pred             CEEEEEECHHH-CcCCCCCCCCCcCCcEEEEEEEE
Confidence            99999999995 88866667799999999976443
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure