Citrus Sinensis ID: 031165

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----

MPAGHGLRSRTRDLFARPFRKKGYIPLSTYLRTYKIGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIKKRIHVRVEHVQPSRCTEEFKLRKKKNDELKADAKARGEVISTKRQPKGPKPGFMVEGATLETVTPIPYDVVNDLKGGY

ccccccccccccccccccccccccccHHHHHHHHccccEEEEEEcccEECccccccccccCEEEEEEcccEEEEEEEcccccEEEcEEEEEEEcEECccccHHHHHHHHHHcHHHHHHHHHcccEEEEEccccccccCEEECccccEEEccccccccccccccc

************DLFARPFRKKGYIPLSTYLRTYKIGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIKKRIHVRVEHVQPSRCTEEFKLRKKKNDELKADAKARGEVISTKRQPKGPKPGFMVEGATLETVTPIPYDVVNDLKGG*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MPAGHGLRSRTRDLFARPFRKKGYIPLSTYLRTYKIGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIKKRIHVRVEHVQPSRCTEEFKLRKKKNDELKADAKARGEVISTKRQPKGPKPGFMVEGATLETVTPIPYDVVNDLKGGY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
60S ribosomal protein L21-2		confident	Q9FDZ9
60S ribosomal protein L21-1		confident	Q43291
60S ribosomal protein L21-A		probable	Q02753

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IZR, chain U
Confidence level:very confident
Coverage over the Query: 1-164
View the alignment between query and template
View the model in PyMOL