Citrus Sinensis ID: 031174
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 164 | ||||||
| 351723659 | 321 | probable aldo-keto reductase 1 [Glycine | 0.993 | 0.507 | 0.717 | 2e-67 | |
| 378548275 | 346 | RecName: Full=Probable aldo-keto reducta | 0.993 | 0.471 | 0.717 | 3e-67 | |
| 449445274 | 347 | PREDICTED: probable aldo-keto reductase | 0.963 | 0.455 | 0.740 | 5e-67 | |
| 255542314 | 343 | aldo/keto reductase, putative [Ricinus c | 0.975 | 0.466 | 0.718 | 6e-66 | |
| 357512299 | 350 | Aldo/keto-reductase family protein [Medi | 0.975 | 0.457 | 0.706 | 7e-66 | |
| 255648228 | 339 | unknown [Glycine max] | 0.975 | 0.471 | 0.712 | 3e-64 | |
| 116781851 | 339 | unknown [Picea sitchensis] | 0.975 | 0.471 | 0.712 | 7e-64 | |
| 224284965 | 339 | unknown [Picea sitchensis] | 0.975 | 0.471 | 0.712 | 7e-64 | |
| 255552041 | 343 | aldo/keto reductase, putative [Ricinus c | 0.975 | 0.466 | 0.708 | 1e-63 | |
| 363808134 | 348 | uncharacterized protein LOC100811411 [Gl | 0.975 | 0.459 | 0.675 | 1e-63 |
| >gi|351723659|ref|NP_001236007.1| probable aldo-keto reductase 1 [Glycine max] gi|224555758|gb|ACN56468.1| putative alto/keto reductase [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 260 bits (664), Expect = 2e-67, Method: Compositional matrix adjust.
Identities = 117/163 (71%), Positives = 143/163 (87%)
Query: 1 MEWSLWTRDIEEEIVPLCRELGIGIVPYSPIGRGFFAGKAVVESLPADSFVASHPRFKEE 60
+EWSLWTRDIEEEIVPLCRELGIGIVPYSP+GRGFF GK VVE++P +S + +HPRF+ E
Sbjct: 156 IEWSLWTRDIEEEIVPLCRELGIGIVPYSPLGRGFFGGKGVVENVPTNSSLKAHPRFQAE 215
Query: 61 NLEKNKNIYIRIDNLAKKHKCTPAQLALAWILQQGDDVIPIPGTSKIKNLDDNIGSLALK 120
NL+KNKNIY RI+ LAKKH+ TPAQLALAW+LQQG+DV+PIPGT+KIKNLD NIG+LA+K
Sbjct: 216 NLDKNKNIYERIEGLAKKHQATPAQLALAWVLQQGEDVVPIPGTTKIKNLDQNIGALAVK 275
Query: 121 LTKEDLKEIADAVPIQEVEGDRTYESMKKVSWKLANTPPKDTK 163
L+++DL+EI++AVPI +V G R Y + SWK ANTPPKD+K
Sbjct: 276 LSEKDLREISEAVPIGDVAGGRYYNGLDHFSWKYANTPPKDSK 318
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|378548275|sp|C6TBN2.1|AKR1_SOYBN RecName: Full=Probable aldo-keto reductase 1; Short=GmAKR1 gi|255637828|gb|ACU19234.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449445274|ref|XP_004140398.1| PREDICTED: probable aldo-keto reductase 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255542314|ref|XP_002512220.1| aldo/keto reductase, putative [Ricinus communis] gi|223548181|gb|EEF49672.1| aldo/keto reductase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357512299|ref|XP_003626438.1| Aldo/keto-reductase family protein [Medicago truncatula] gi|355501453|gb|AES82656.1| Aldo/keto-reductase family protein [Medicago truncatula] gi|388512861|gb|AFK44492.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255648228|gb|ACU24567.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|116781851|gb|ABK22267.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|224284965|gb|ACN40212.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|255552041|ref|XP_002517065.1| aldo/keto reductase, putative [Ricinus communis] gi|223543700|gb|EEF45228.1| aldo/keto reductase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|363808134|ref|NP_001242478.1| uncharacterized protein LOC100811411 [Glycine max] gi|255637199|gb|ACU18930.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 164 | ||||||
| TAIR|locus:2036504 | 345 | ATB2 [Arabidopsis thaliana (ta | 0.957 | 0.455 | 0.568 | 6.4e-44 | |
| TAIR|locus:2036611 | 345 | AT1G60690 "AT1G60690" [Arabido | 0.957 | 0.455 | 0.537 | 5.7e-43 | |
| TAIR|locus:2036591 | 346 | AT1G60680 "AT1G60680" [Arabido | 0.957 | 0.453 | 0.525 | 2.5e-42 | |
| TAIR|locus:2196446 | 344 | AT1G10810 "AT1G10810" [Arabido | 0.951 | 0.453 | 0.527 | 2.8e-41 | |
| TAIR|locus:2036551 | 330 | AT1G60750 [Arabidopsis thalian | 0.859 | 0.427 | 0.515 | 1.5e-37 | |
| TIGR_CMR|SPO_A0345 | 327 | SPO_A0345 "oxidoreductase, ald | 0.908 | 0.455 | 0.403 | 1.5e-28 | |
| TIGR_CMR|GSU_3126 | 334 | GSU_3126 "oxidoreductase, aldo | 0.914 | 0.449 | 0.397 | 4e-26 | |
| POMBASE|SPAC1F7.12 | 340 | yak3 "aldose reductase ARK13 f | 0.865 | 0.417 | 0.404 | 2.2e-25 | |
| ASPGD|ASPL0000046075 | 356 | AN9051 [Emericella nidulans (t | 0.957 | 0.441 | 0.388 | 2.6e-24 | |
| UNIPROTKB|G4NAH9 | 341 | MGG_09715 "Aldo-keto reductase | 0.859 | 0.413 | 0.402 | 5.3e-24 |
| TAIR|locus:2036504 ATB2 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 463 (168.0 bits), Expect = 6.4e-44, P = 6.4e-44
Identities = 91/160 (56%), Positives = 119/160 (74%)
Query: 1 MEWSLWTRDIEEEIVPLCRELGIGIVPYSPIGRGFFA-GKAVVESLPADSFVASHPRFKE 59
+EWSLWTRD+EEEI+P CRELGIGIV YSP+GRGFFA G +VE+L D F + PRF+E
Sbjct: 181 IEWSLWTRDVEEEIIPTCRELGIGIVAYSPLGRGFFASGPKLVENLEKDDFRKALPRFQE 240
Query: 60 ENLEKNKNIYIRIDNLAKKHKCTPAQLALAWILQQGDDVIPIPGTSKIKNLDDNIGSLAL 119
ENL+ NK +Y ++ +++K CTP QLALAW+ QGDDV PIPGT+KI+NL NIG+L++
Sbjct: 241 ENLDHNKIVYEKVCAISEKKGCTPGQLALAWVHHQGDDVCPIPGTTKIENLKQNIGALSV 300
Query: 120 KLTKEDLKEIADAVPIQEVEGDRTYESMKKVSWKLANTPP 159
KLT E++ E+ V+GDR Y +M ++K A TPP
Sbjct: 301 KLTPEEMTELEAIAQPGFVKGDR-YSNMIP-TFKNAETPP 338
|
|
| TAIR|locus:2036611 AT1G60690 "AT1G60690" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036591 AT1G60680 "AT1G60680" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2196446 AT1G10810 "AT1G10810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036551 AT1G60750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_A0345 SPO_A0345 "oxidoreductase, aldo/keto reductase family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_3126 GSU_3126 "oxidoreductase, aldo/keto reductase family" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC1F7.12 yak3 "aldose reductase ARK13 family YakC" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000046075 AN9051 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NAH9 MGG_09715 "Aldo-keto reductase yakc" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| OsI_33599 | Os10g0419100 (370 aa) | |||||||
(Oryza sativa Indica) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 164 | |||
| COG0667 | 316 | COG0667, Tas, Predicted oxidoreductases (related t | 9e-42 | |
| cd06660 | 285 | cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) | 5e-37 | |
| pfam00248 | 277 | pfam00248, Aldo_ket_red, Aldo/keto reductase famil | 4e-32 | |
| COG0656 | 280 | COG0656, ARA1, Aldo/keto reductases, related to di | 6e-18 | |
| PRK11172 | 267 | PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B | 9e-13 | |
| PRK10376 | 290 | PRK10376, PRK10376, putative oxidoreductase; Provi | 3e-09 | |
| PRK10625 | 346 | PRK10625, tas, putative aldo-keto reductase; Provi | 6e-09 | |
| PRK09912 | 346 | PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r | 1e-05 | |
| PRK11565 | 275 | PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A | 6e-05 | |
| COG4989 | 298 | COG4989, COG4989, Predicted oxidoreductase [Genera | 8e-05 | |
| TIGR01293 | 317 | TIGR01293, Kv_beta, voltage-dependent potassium ch | 9e-05 |
| >gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
Score = 141 bits (357), Expect = 9e-42
Identities = 53/133 (39%), Positives = 80/133 (60%), Gaps = 2/133 (1%)
Query: 1 MEWSLWTRDIEEEIVPLCRELGIGIVPYSPIGRGFFAGKAVVESLPADSFVASHPRFKEE 60
E++L RD E+E++PLCRE GIG++ YSP+ G GK P S + PRF+ E
Sbjct: 178 PEYNLLERDAEKELLPLCREEGIGLLAYSPLASGLLTGK--YLPGPEGSRASELPRFQRE 235
Query: 61 NLEKNKNIYIRIDNLAKKHKCTPAQLALAWILQQGDDVIPIPGTSKIKNLDDNIGSLALK 120
E+ I ++ LAK+ TPAQ+ALAW+L Q PI G SK + L++N+ +L +K
Sbjct: 236 LTERGLAILRALEELAKELGATPAQVALAWVLAQPGVTSPIVGASKAEQLEENLAALDIK 295
Query: 121 LTKEDLKEIADAV 133
L++E+L + +
Sbjct: 296 LSEEELAALDEIS 308
|
Length = 316 |
| >gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family | Back alignment and domain information |
|---|
| >gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 164 | |||
| KOG1575 | 336 | consensus Voltage-gated shaker-like K+ channel, su | 99.97 | |
| COG0667 | 316 | Tas Predicted oxidoreductases (related to aryl-alc | 99.96 | |
| PRK10625 | 346 | tas putative aldo-keto reductase; Provisional | 99.94 | |
| TIGR01293 | 317 | Kv_beta voltage-dependent potassium channel beta s | 99.93 | |
| PRK09912 | 346 | L-glyceraldehyde 3-phosphate reductase; Provisiona | 99.92 | |
| PF00248 | 283 | Aldo_ket_red: Aldo/keto reductase family; InterPro | 99.88 | |
| PLN02587 | 314 | L-galactose dehydrogenase | 99.88 | |
| COG0656 | 280 | ARA1 Aldo/keto reductases, related to diketogulona | 99.87 | |
| PRK11172 | 267 | dkgB 2,5-diketo-D-gluconate reductase B; Provision | 99.85 | |
| cd06660 | 285 | Aldo_ket_red Aldo-keto reductases (AKRs) are a sup | 99.84 | |
| PRK14863 | 292 | bifunctional regulator KidO; Provisional | 99.83 | |
| PRK10376 | 290 | putative oxidoreductase; Provisional | 99.81 | |
| KOG1577 | 300 | consensus Aldo/keto reductase family proteins [Gen | 99.81 | |
| PRK11565 | 275 | dkgA 2,5-diketo-D-gluconate reductase A; Provision | 99.8 | |
| COG4989 | 298 | Predicted oxidoreductase [General function predict | 99.74 | |
| COG1453 | 391 | Predicted oxidoreductases of the aldo/keto reducta | 99.52 | |
| KOG1576 | 342 | consensus Predicted oxidoreductase [Energy product | 99.44 |
| >KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=99.97 E-value=1.4e-30 Score=205.73 Aligned_cols=142 Identities=43% Similarity=0.724 Sum_probs=126.6
Q ss_pred Ccccccccc-hhhhHHHHHHHhCCeEeecccccccccCCC-CCCCCCCCCcccccCCC----CchhhHHHHHHHHHHHHH
Q 031174 1 MEWSLWTRD-IEEEIVPLCRELGIGIVPYSPIGRGFFAGK-AVVESLPADSFVASHPR----FKEENLEKNKNIYIRIDN 74 (164)
Q Consensus 1 v~ynll~r~-~e~~~l~~~~~~gi~v~a~spLa~G~Ltg~-~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~l~~ 74 (164)
++|||+.|+ .|++++++|++.||++++||||++|+|||+ ....+.+.++.+..... +..+ +.++.+++++++
T Consensus 188 ~eysl~~Rd~ee~~i~~~c~~~Gi~li~ysPL~~G~Ltgk~~~~e~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~ 265 (336)
T KOG1575|consen 188 VEYSLLSRDKEERGIIPLCRELGIGLIAWSPLGRGLLTGKYKLGEDSRNGDKRFQFLGLSPQTEEG--DKQKPILEALSK 265 (336)
T ss_pred eechhhhcchhhhhHHHHHHHcCcceEEecccccceeccCcccccccccccccccccccccccchh--hhHHHHHHHHHH
Confidence 589999999 557799999999999999999999999999 55566777766554433 3333 778899999999
Q ss_pred HHHHcCCCHHHHHHHHHHcCCCceeecCCCCCHHHHHHhHhccCCcCCHHHHHHHHhhCCCCccCCCcch
Q 031174 75 LAKKHKCTPAQLALAWILQQGDDVIPIPGTSKIKNLDDNIGSLALKLTKEDLKEIADAVPIQEVEGDRTY 144 (164)
Q Consensus 75 ia~~~g~s~~qlaL~w~l~~~~v~~~I~G~~~~~~l~enl~a~~~~Lt~e~~~~l~~~~~~~~~~~~~~~ 144 (164)
+|+++|+|++|+||+|+++++.+++||||+++.+||+||++|+.+.|+++++.+|+++.+.....+++|.
T Consensus 266 iA~k~g~T~~qlALawv~~~~~v~~pIpG~s~ve~l~eni~Al~~~Lt~e~~~~l~~~~~~~~~~~~~~~ 335 (336)
T KOG1575|consen 266 IAEKHGCTVPQLALAWVLSNGKVSSPIPGASKIEQLKENIGALSVKLTPEEIKELEEIIDKILGFGPRSI 335 (336)
T ss_pred HHHHcCCCHHHHHHHHHHHhCCCEEecCCCCcHHHHHHHHhhhhccCCHHHHHHHHHhhccccCcCCCCC
Confidence 9999999999999999999999999999999999999999999999999999999999999888888764
|
|
| >COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK10625 tas putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
| >PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] | Back alignment and domain information |
|---|
| >PLN02587 L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
| >cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >PRK14863 bifunctional regulator KidO; Provisional | Back alignment and domain information |
|---|
| >PRK10376 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >COG4989 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 164 | ||||
| 3uyi_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 7e-66 | ||
| 3v0u_A | 338 | Crystal Structure Of Perakine Reductase, Founder Me | 9e-65 | ||
| 3v0t_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 9e-65 | ||
| 3v0s_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 4e-64 | ||
| 1pyf_A | 312 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 2e-11 | ||
| 1lqa_A | 346 | Tas Protein From Escherichia Coli In Complex With N | 5e-10 | ||
| 3erp_A | 353 | Structure Of Idp01002, A Putative Oxidoreductase Fr | 2e-09 | ||
| 3n2t_A | 348 | Structure Of The Glycerol Dehydrogenase Akr11b4 Fro | 2e-07 | ||
| 1pz1_A | 333 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 5e-06 | ||
| 4fzi_A | 290 | Crystal Structure Of Prostaglandin F Synthase From | 2e-05 | ||
| 1vp5_A | 298 | Crystal Structure Of 2,5-diketo-d-gluconic Acid Red | 4e-05 | ||
| 3n6q_A | 346 | Crystal Structure Of Yghz From E. Coli Length = 346 | 6e-05 | ||
| 4aub_A | 366 | The Complex Structure Of The Bacterial Aldo-Keto Re | 6e-05 | ||
| 3o3r_A | 316 | Crystal Structure Of Akr1b14 In Complex With Nadp L | 7e-05 | ||
| 3qkz_A | 316 | Crystal Structure Of Mutant His269arg Akr1b14 Lengt | 1e-04 | ||
| 3lut_A | 367 | A Structural Model For The Full-Length Shaker Potas | 3e-04 | ||
| 3eb3_A | 327 | Voltage-Dependent K+ Channel Beta Subunit (W121a) I | 3e-04 | ||
| 3eb4_A | 327 | Voltage-Dependent K+ Channel Beta Subunit (I211r) I | 3e-04 | ||
| 3eau_A | 327 | Voltage-Dependent K+ Channel Beta Subunit In Comple | 3e-04 | ||
| 2a79_A | 333 | Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu | 3e-04 | ||
| 1qrq_A | 325 | Structure Of A Voltage-Dependent K+ Channel Beta Su | 3e-04 | ||
| 1exb_A | 332 | Structure Of The Cytoplasmic Beta Subunit-T1 Assemb | 3e-04 | ||
| 1zsx_A | 347 | Crystal Structure Of Human Potassium Channel Kv Bet | 5e-04 | ||
| 3uwe_A | 331 | Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length | 5e-04 | ||
| 2fvl_A | 324 | Crystal Structure Of Human 3-alpha Hydroxysteroid/d | 5e-04 | ||
| 3r43_A | 331 | Akr1c3 Complexed With Mefenamic Acid Length = 331 | 6e-04 | ||
| 1ry0_A | 323 | Structure Of Prostaglandin F Synthase With Prostagl | 6e-04 | ||
| 1s1p_A | 331 | Crystal Structures Of Prostaglandin D2 11-Ketoreduc | 6e-04 | ||
| 2bgq_A | 344 | Apo Aldose Reductase From Barley Length = 344 | 6e-04 |
| >pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
|
| >pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 | Back alignment and structure |
| >pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 | Back alignment and structure |
| >pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 | Back alignment and structure |
| >pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 | Back alignment and structure |
| >pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 | Back alignment and structure |
| >pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 | Back alignment and structure |
| >pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 | Back alignment and structure |
| >pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 | Back alignment and structure |
| >pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 | Back alignment and structure |
| >pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 | Back alignment and structure |
| >pdb|3O3R|A Chain A, Crystal Structure Of Akr1b14 In Complex With Nadp Length = 316 | Back alignment and structure |
| >pdb|3QKZ|A Chain A, Crystal Structure Of Mutant His269arg Akr1b14 Length = 316 | Back alignment and structure |
| >pdb|3LUT|A Chain A, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 367 | Back alignment and structure |
| >pdb|3EB3|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (W121a) In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|3EB4|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (I211r) In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|3EAU|A Chain A, Voltage-Dependent K+ Channel Beta Subunit In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|2A79|A Chain A, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 333 | Back alignment and structure |
| >pdb|1QRQ|A Chain A, Structure Of A Voltage-Dependent K+ Channel Beta Subunit Length = 325 | Back alignment and structure |
| >pdb|1EXB|A Chain A, Structure Of The Cytoplasmic Beta Subunit-T1 Assembly Of Voltage-Dependent K Channels Length = 332 | Back alignment and structure |
| >pdb|1ZSX|A Chain A, Crystal Structure Of Human Potassium Channel Kv Beta-Subunit (Kcnab2) Length = 347 | Back alignment and structure |
| >pdb|3UWE|A Chain A, Akr1c3 Complexed With 3-Phenoxybenzoic Acid Length = 331 | Back alignment and structure |
| >pdb|2FVL|A Chain A, Crystal Structure Of Human 3-alpha Hydroxysteroid/dihydrodiol Dehydrogenase (akr1c4) Complexed With Nadp+ Length = 324 | Back alignment and structure |
| >pdb|3R43|A Chain A, Akr1c3 Complexed With Mefenamic Acid Length = 331 | Back alignment and structure |
| >pdb|1RY0|A Chain A, Structure Of Prostaglandin F Synthase With Prostaglandin D2 Length = 323 | Back alignment and structure |
| >pdb|1S1P|A Chain A, Crystal Structures Of Prostaglandin D2 11-Ketoreductase (Akr1c3) In Complex With The Non-Steroidal Anti- Inflammatory Drugs Flufenamic Acid And Indomethacin Length = 331 | Back alignment and structure |
| >pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 164 | |||
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 4e-74 | |
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 3e-69 | |
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 4e-66 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 4e-58 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 8e-45 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 1e-36 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 4e-30 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 4e-30 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 2e-29 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 1e-28 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 2e-24 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 4e-24 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 1e-23 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 1e-14 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 2e-14 | |
| 2ao0_A | 324 | Aldehyde dehydrogenase; TIM barrel, aldo-keto redu | 3e-14 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 3e-14 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 4e-14 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 5e-14 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 5e-14 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 8e-14 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 1e-13 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 1e-13 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 2e-13 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 5e-13 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 5e-13 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 8e-13 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 1e-11 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 1e-11 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 4e-11 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 6e-11 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 8e-11 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 1e-10 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 1e-10 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 1e-10 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 2e-10 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 2e-10 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 2e-10 |
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 | Back alignment and structure |
|---|
Score = 224 bits (572), Expect = 4e-74
Identities = 109/159 (68%), Positives = 133/159 (83%)
Query: 1 MEWSLWTRDIEEEIVPLCRELGIGIVPYSPIGRGFFAGKAVVESLPADSFVASHPRFKEE 60
+E+SLWTRDIE+EIVPLCR+LGIGIVPYSPIGRG F GKA+ ESLP +S + SHPRF E
Sbjct: 177 IEYSLWTRDIEDEIVPLCRQLGIGIVPYSPIGRGLFWGKAIKESLPENSVLTSHPRFVGE 236
Query: 61 NLEKNKNIYIRIDNLAKKHKCTPAQLALAWILQQGDDVIPIPGTSKIKNLDDNIGSLALK 120
NLEKNK IY RI+ L++KH CTP QLALAW+L QG+DV+PIPGT+KIKNL +N+G+L +
Sbjct: 237 NLEKNKQIYYRIEALSQKHGCTPVQLALAWVLHQGEDVVPIPGTTKIKNLHNNVGALKVX 296
Query: 121 LTKEDLKEIADAVPIQEVEGDRTYESMKKVSWKLANTPP 159
LTKEDLKEI+DAVP+ EV G+ +E + +WK ANTPP
Sbjct: 297 LTKEDLKEISDAVPLDEVAGESIHEVIAVTNWKFANTPP 335
|
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 | Back alignment and structure |
|---|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 164 | |||
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 100.0 | |
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 99.97 | |
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 99.96 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 99.96 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 99.95 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 99.95 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 99.95 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 99.94 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 99.94 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 99.93 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 99.92 | |
| 3b3d_A | 314 | YTBE protein, putative morphine dehydrogenase; ald | 99.91 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 99.91 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 99.91 | |
| 4gac_A | 324 | Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe | 99.9 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 99.9 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 99.89 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 99.89 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 99.89 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 99.89 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 99.89 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 99.88 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 99.88 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 99.88 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 99.88 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 99.87 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 99.87 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 99.87 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 99.87 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 99.87 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 99.87 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 99.87 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 99.87 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 99.86 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 99.86 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 99.86 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 99.86 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 99.85 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 99.85 | |
| 4exb_A | 292 | Putative uncharacterized protein; aldo-keto reduct | 99.79 |
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.7e-33 Score=224.87 Aligned_cols=160 Identities=68% Similarity=1.180 Sum_probs=111.7
Q ss_pred CcccccccchhhhHHHHHHHhCCeEeecccccccccCCCCCCCCCCCCcccccCCCCchhhHHHHHHHHHHHHHHHHHcC
Q 031174 1 MEWSLWTRDIEEEIVPLCRELGIGIVPYSPIGRGFFAGKAVVESLPADSFVASHPRFKEENLEKNKNIYIRIDNLAKKHK 80 (164)
Q Consensus 1 v~ynll~r~~e~~~l~~~~~~gi~v~a~spLa~G~Ltg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ia~~~g 80 (164)
++||+++++.+.+++++|+++||++++||||++|+|+|+.....+++++.+...|.|.++.+++++++++.++++|+++|
T Consensus 177 ~~~~~~~~~~e~~l~~~~~~~gi~v~a~spL~~G~L~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ia~~~g 256 (337)
T 3v0s_A 177 IEYSLWTRDIEDEIVPLCRQLGIGIVPYSPIGRGLFWGKAIKESLPENSVLTSHPRFVGENLEKNKQIYYRIEALSQKHG 256 (337)
T ss_dssp EECBTTBCGGGTTHHHHHHHHTCEEEEESTTHHHHHHHHHHHC-------------------------CHHHHHHHHHTT
T ss_pred eeccccccchhHHHHHHHHHcCceEEEeccccCcccCCCCCCCCCCCcchhhcccccchhhhhhHHHHHHHHHHHHHHhC
Confidence 47999999988899999999999999999999999998744455666777777788888888888999999999999999
Q ss_pred CCHHHHHHHHHHcCCCceeecCCCCCHHHHHHhHhccCCcCCHHHHHHHHhhCCCCccCCCcchHHHhhhhccccCCCCC
Q 031174 81 CTPAQLALAWILQQGDDVIPIPGTSKIKNLDDNIGSLALKLTKEDLKEIADAVPIQEVEGDRTYESMKKVSWKLANTPPK 160 (164)
Q Consensus 81 ~s~~qlaL~w~l~~~~v~~~I~G~~~~~~l~enl~a~~~~Lt~e~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 160 (164)
+|++|+||+|+++++.|++||+|+++++||++|+++++++||+++++.|+++.+..++.|.+|+.......|.+++|||.
T Consensus 257 ~t~aqvaL~w~l~~~~v~~~I~g~~~~~~l~en~~a~~~~L~~e~~~~l~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~ 336 (337)
T 3v0s_A 257 CTPVQLALAWVLHQGEDVVPIPGTTKIKNLHNNVGALKVXLTKEDLKEISDAVPLDEVAGESIHEVIAVTNWKFANTPPL 336 (337)
T ss_dssp SCHHHHHHHHHHTTCTTBCCCCCCSCHHHHHHHHHGGGCCCCHHHHHHHHHTCC-----------------CTTCCCCCC
T ss_pred CCHHHHHHHHHHhCCCCeEEEcCCCCHHHHHHHHHHhccCCCHHHHHHHHHhhcccCCCCCCchHHHhhhhhhcCCCCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999998444446789999985
|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 | Back alignment and structure |
|---|
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* | Back alignment and structure |
|---|
| >3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* | Back alignment and structure |
|---|
| >4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* | Back alignment and structure |
|---|
| >4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 164 | ||||
| d1lqaa_ | 346 | c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: | 1e-33 | |
| d1pyfa_ | 311 | c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu | 2e-29 | |
| d3eaua1 | 326 | c.1.7.1 (A:36-361) Voltage-dependent K+ channel be | 8e-27 | |
| d1s1pa_ | 315 | c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak | 1e-22 | |
| d1qwka_ | 312 | c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod | 3e-22 | |
| d1gvea_ | 324 | c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) | 6e-21 | |
| d1afsa_ | 319 | c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase | 2e-20 | |
| d1us0a_ | 314 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 2e-20 | |
| d1frba_ | 315 | c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce | 3e-19 | |
| d1ur3m_ | 298 | c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc | 3e-18 | |
| d1hqta_ | 324 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 4e-18 | |
| d1mi3a_ | 319 | c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu | 7e-18 | |
| d1hw6a_ | 262 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 7e-17 | |
| d1pz1a_ | 333 | c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu | 2e-16 | |
| d1mzra_ | 274 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 3e-16 | |
| d1vp5a_ | 284 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 4e-14 |
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: Tas protein species: Escherichia coli [TaxId: 562]
Score = 119 bits (299), Expect = 1e-33
Identities = 38/133 (28%), Positives = 68/133 (51%), Gaps = 1/133 (0%)
Query: 1 MEWSLWTRDIEEEIVPLCRELGIGIVPYSPIGRGFFAGKAVVESLPADSFVASHPRFKEE 60
+SL R E + + + G+ ++ YS +G G GK + + PA + RF
Sbjct: 206 NPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGTLTGKYLNGAKPAGARNTLFSRFTRY 265
Query: 61 NLEKNKNIYIRIDNLAKKHKCTPAQLALAWILQQGDDVIPIPGTSKIKNLDDNIGSLALK 120
+ E+ + ++A++H PAQ+ALA++ +Q + G + + L NI SL L+
Sbjct: 266 SGEQTQKAVAAYVDIARRHGLDPAQMALAFVRRQPFVASTLLGATTMDQLKTNIESLHLE 325
Query: 121 LTKEDLKEIADAV 133
L+++ L EI +AV
Sbjct: 326 LSEDVLAEI-EAV 337
|
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 | Back information, alignment and structure |
|---|
| >d1gvea_ c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 324 | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 164 | |||
| d1lqaa_ | 346 | Tas protein {Escherichia coli [TaxId: 562]} | 99.95 | |
| d1pyfa_ | 311 | Putative oxidoreductase IolS {Bacillus subtilis [T | 99.95 | |
| d1pz1a_ | 333 | Putative oxidoreductase YhdN {Bacillus subtilis [T | 99.94 | |
| d1gvea_ | 324 | Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus | 99.93 | |
| d3eaua1 | 326 | Voltage-dependent K+ channel beta subunit {Rat (Ra | 99.91 | |
| d1qwka_ | 312 | Hypothetical protein C07D8.6 {Nematode (Caenorhabd | 99.88 | |
| d1afsa_ | 319 | 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus | 99.87 | |
| d1hqta_ | 324 | Aldose reductase (aldehyde reductase) {Pig (Sus sc | 99.87 | |
| d1frba_ | 315 | FR-1 (fibroblast growth factor-induced) protein {M | 99.87 | |
| d1s1pa_ | 315 | Prostaglandin d2 11-ketoreductase (akr1c3) {Human | 99.86 | |
| d1hw6a_ | 262 | 2,5-diketo-D-gluconic acid reductase A {Corynebact | 99.86 | |
| d1us0a_ | 314 | Aldose reductase (aldehyde reductase) {Human (Homo | 99.84 | |
| d1mzra_ | 274 | 2,5-diketo-D-gluconic acid reductase A {Escherichi | 99.84 | |
| d1mi3a_ | 319 | Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 | 99.84 | |
| d1ur3m_ | 298 | Hypothetical oxidoreductase YdhF {Escherichia coli | 99.76 | |
| d1vp5a_ | 284 | 2,5-diketo-D-gluconic acid reductase A {Thermotoga | 99.73 |
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: Tas protein species: Escherichia coli [TaxId: 562]
Probab=99.95 E-value=2.7e-28 Score=192.89 Aligned_cols=138 Identities=26% Similarity=0.375 Sum_probs=123.9
Q ss_pred CcccccccchhhhHHHHHHHhCCeEeecccccccccCCCCCCCCCCCCcccccCCCCchhhHHHHHHHHHHHHHHHHHcC
Q 031174 1 MEWSLWTRDIEEEIVPLCRELGIGIVPYSPIGRGFFAGKAVVESLPADSFVASHPRFKEENLEKNKNIYIRIDNLAKKHK 80 (164)
Q Consensus 1 v~ynll~r~~e~~~l~~~~~~gi~v~a~spLa~G~Ltg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ia~~~g 80 (164)
++||+++|.++.+++++|+++||++++|+||++|+|+|++.....|.+......+.+.........++++.+.++|+++|
T Consensus 206 ~~yn~~~~~~e~~~~~~~~~~~i~v~a~~pl~~G~Ltg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~g 285 (346)
T d1lqaa_ 206 NPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGTLTGKYLNGAKPAGARNTLFSRFTRYSGEQTQKAVAAYVDIARRHG 285 (346)
T ss_dssp EECBTTBCTHHHHHHHHHHHHCCEEEEECTTGGGGGGTTTGGGCCCTTCHHHHCTTCCTTCSHHHHHHHHHHHHHHHHTT
T ss_pred CCCccccchHHHHHHHHHHHhCCeEEEecccccccccCCccCCCCCccccccccchhhhhhHHHHHHHHHHHHHHHHHHC
Confidence 36999999998999999999999999999999999999966555566555555666666777888899999999999999
Q ss_pred CCHHHHHHHHHHcCCCceeecCCCCCHHHHHHhHhccCCcCCHHHHHHHHhhCCCCcc
Q 031174 81 CTPAQLALAWILQQGDDVIPIPGTSKIKNLDDNIGSLALKLTKEDLKEIADAVPIQEV 138 (164)
Q Consensus 81 ~s~~qlaL~w~l~~~~v~~~I~G~~~~~~l~enl~a~~~~Lt~e~~~~l~~~~~~~~~ 138 (164)
+|++|+||+|++++++|++||+|+++++||++|+++++++||++++++|+++.+..+.
T Consensus 286 ~s~aq~al~~~l~~~~v~~vl~G~~~~~~l~enl~~~~~~L~~e~~~~i~~i~~~~~~ 343 (346)
T d1lqaa_ 286 LDPAQMALAFVRRQPFVASTLLGATTMDQLKTNIESLHLELSEDVLAEIEAVHQVYTY 343 (346)
T ss_dssp CCHHHHHHHHHHTCTTEEEEEECCSSHHHHHHHHGGGGCCCCHHHHHHHHHHHHHSCS
T ss_pred cCHHHHHHHHHHHCCCCeEEEECCCCHHHHHHHHHhcCCCCCHHHHHHHHhhccccCC
Confidence 9999999999999999999999999999999999999999999999999999876654
|
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1gvea_ c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|