Citrus Sinensis ID: 031186


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MELALQSLSSASFSIITRDLKLRVCTGLHGKAFSSIDIKSQEQERKLPTVSSALPETAASVAIAATVVGAAATLLVRRTKGSEETEIPLKTCEDCGGSGICPECKGEGFVLKKLSEETAERARLTAKNMATRYTAGLPKKWSYCTKCSSSRSCATCGGRGKLSL
ccccccccccccccEEEccEEEEEECcccccccccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEEcccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccc
********SSASFSIITRDLKLRVCTGLHGKAFSSI****************ALPETAASVAIAATVVGAAATLLVRRTKG********KTCEDCGGSGICPECKGEGFVLKKLS*******RLTAKNMATRYTAGLPKKWSYCTKCSSSRSCATCGGRG****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELALQSLSSASFSIITRDLKLRVCTGLHGKAFSSIDIKSQEQERKLPTVSSALPETAASVAIAATVVGAAATLLVRRTKGSEETEIPLKTCEDCGGSGICPECKGEGFVLKKLSEETAERARLTAKNMATRYTAGLPKKWSYCTKCSSSRSCATCGGRGKLSL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NLT, chain A
Confidence level:probable
Coverage over the Query: 89-113,131-162
View the alignment between query and template
View the model in PyMOL
Template: 1QZV, chain F
Confidence level:probable
Coverage over the Query: 55-67
View the alignment between query and template
View the model in PyMOL