Citrus Sinensis ID: 031196

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----

MVEEKADKILSESQESNVAFLVVGDPFGATTHTDLVVRAKKLGIQVKAVHNASVMNAVGICGLQLYRFGETVSIPFFTETWRPGSFYEKIKRNRSLGLHTLCLLDIRVKEPSLESLCRGKKLYEPPRYMTVNIAIEQLLEVELLQGESGKAHELKIILKQLQTS

cccccHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHccccEEEEcccHHHHHHHHHcccccccccEEEEEccccccccccHHHHHHHHHHccccccEEEEHHcccccHHHHHcccccccccccccHHHHHHHHHHHHHHHccccccccEEEEEEEcccc

***EKADKILSESQESNVAFLVVGDPFGATTHTDLVVRAKKLGIQVKAVHNASVMNAVGICGLQLYRFGETVSIPFFTETWRPGSFYEKIKRNRSLGLHTLCLLDIRVKEPSLESLCRGKKLYEPPRYMTVNIAIEQLLEVELLQGESGKAHELKIILKQLQT*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVEEKADKILSESQESNVAFLVVGDPFGATTHTDLVVRAKKLGIQVKAVHNASVMNAVGICGLQLYRFGETVSIPFFTETWRPGSFYEKIKRNRSLGLHTLCLLDIRVKEPSLESLCRGKKLYEPPRYMTVNIAIEQLLEVELLQGESGKAHELKIILKQLQTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable diphthine synthase	S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the trimethylation of the amino group of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine. The three successive methylation reactions represent the second step of diphthamide biosynthesis.	probable	O81769

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I4T, chain A
Confidence level:very confident
Coverage over the Query: 5-110,124-162
View the alignment between query and template
View the model in PyMOL