Citrus Sinensis ID: 031243

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MAKPKAPRRTLESYTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSDW
cccccccccEEEEEEEEEccEEEEcccEEEEEccccccccEEEEEEEEEEcccccEEEEEEEEEEccccccccccccccccEEEEEccccccccccEEcccEEEEccccccccccccccEEEEEEEEccccEEcccccEEcccccccccccccEEEccccccc
ccccccccccEcEEEEEcccEEEEcccEEEEEccccccccEEEEEEEEEEccccccEEEEEEEEEccccccccccccccccEEEEcccccccccEEEcccEEEEEHHHHHHHcccccccEEEEEEEccccccccccccEEEEEEcccccccccEEEccccccc
makpkaprrtlesytvksisktikpgdcvlmrpsepskpsyVAKIERIEsdarganvkvhvrwyyrpeesiggrrqfhgskevflsdhhdiqsadtiegkctvhsfksytkldavgnddffcrfeynsssgafnpdrvavyckcempynpddlmvqcegcsdw
makpkaprrtlesytvksisktikpgdcvlmrpsepskpsyVAKIEriesdarganvkvhvRWYYRpeesiggrrqfHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEynsssgafnpdRVAVYCKCEMPYNPDDLMVQCEGCSDW
MAKPKAPRRTLESYTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSDW
********************************************I*RIE*DARGANVKVHVRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCE*****
*************YTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSDW
*************YTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSDW
********RTLESYTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSDW
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKPKAPRRTLESYTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSDW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query163 2.2.26 [Sep-21-2011]
Q9P2812608 BAH and coiled-coil domai yes no 0.552 0.034 0.344 3e-08
Q3UHR02643 BAH and coiled-coil domai yes no 0.552 0.034 0.344 4e-08
Q8TBE0780 Bromo adjacent homology d no no 0.613 0.128 0.377 2e-07
Q497V6772 Bromo adjacent homology d no no 0.613 0.129 0.367 5e-07
Q8BSQ9 1634 Protein polybromo-1 OS=Mu no no 0.656 0.065 0.315 1e-06
Q86U86 1689 Protein polybromo-1 OS=Ho no no 0.656 0.063 0.315 1e-06
P53236 928 Chromatin structure-remod yes no 0.809 0.142 0.297 1e-06
Q3LHL91658 Protein winged eye OS=Dro no no 0.717 0.070 0.309 2e-06
Q06488 889 Chromatin structure-remod no no 0.883 0.161 0.287 2e-06
Q90941 1633 Protein polybromo-1 OS=Ga no no 0.656 0.065 0.306 2e-06
>sp|Q9P281|BAHC1_HUMAN BAH and coiled-coil domain-containing protein 1 OS=Homo sapiens GN=BAHCC1 PE=1 SV=3 Back     alignment and function desciption
 Score = 57.8 bits (138), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 32/93 (34%), Positives = 54/93 (58%), Gaps = 3/93 (3%)

Query: 21   KTIKPGDC-VLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHG 79
            +T++ GDC V +    P+ P Y+ +IE +  ++ G+N+ V V+W+Y PEE+  G+RQ  G
Sbjct: 2482 ETLRVGDCAVFLSAGRPNLP-YIGRIESM-WESWGSNMVVKVKWFYHPEETKLGKRQCDG 2539

Query: 80   SKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKL 112
               ++ S H D     TI  KC V + + Y ++
Sbjct: 2540 KNALYQSCHEDENDVQTISHKCQVVAREQYEQM 2572

Homo sapiens (taxid: 9606)
>sp|Q3UHR0|BAHC1_MOUSE BAH and coiled-coil domain-containing protein 1 OS=Mus musculus GN=Bahcc1 PE=2 SV=2 Back     alignment and function description
>sp|Q8TBE0|BAHD1_HUMAN Bromo adjacent homology domain-containing 1 protein OS=Homo sapiens GN=BAHD1 PE=1 SV=2 Back     alignment and function description
>sp|Q497V6|BAHD1_MOUSE Bromo adjacent homology domain-containing 1 protein OS=Mus musculus GN=Bahd1 PE=2 SV=1 Back     alignment and function description
>sp|Q8BSQ9|PB1_MOUSE Protein polybromo-1 OS=Mus musculus GN=Pbrm1 PE=1 SV=4 Back     alignment and function description
>sp|Q86U86|PB1_HUMAN Protein polybromo-1 OS=Homo sapiens GN=PBRM1 PE=1 SV=1 Back     alignment and function description
>sp|P53236|RSC1_YEAST Chromatin structure-remodeling complex subunit RSC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC1 PE=1 SV=1 Back     alignment and function description
>sp|Q3LHL9|WGE_DROME Protein winged eye OS=Drosophila melanogaster GN=wge PE=1 SV=1 Back     alignment and function description
>sp|Q06488|RSC2_YEAST Chromatin structure-remodeling complex subunit RSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC2 PE=1 SV=1 Back     alignment and function description
>sp|Q90941|PB1_CHICK Protein polybromo-1 OS=Gallus gallus GN=PBRM1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query163
356516937216 PREDICTED: BAH and coiled-coil domain-co 1.0 0.754 0.914 2e-87
255543795216 phd finger transcription factor, putativ 1.0 0.754 0.914 6e-87
351726182216 uncharacterized protein LOC100526926 [Gl 1.0 0.754 0.907 3e-86
449461597216 PREDICTED: BAH and coiled-coil domain-co 1.0 0.754 0.889 1e-85
224077882215 ebs-bah-phd domain-containing protein [P 1.0 0.758 0.907 3e-85
224105329215 predicted protein [Populus trichocarpa] 1.0 0.758 0.895 1e-83
297744763215 unnamed protein product [Vitis vinifera] 0.993 0.753 0.883 2e-83
225427692224 PREDICTED: chromatin structure-remodelin 0.993 0.723 0.883 2e-83
357467401218 Ebs-bah-phd domain-containing protein [M 1.0 0.747 0.872 2e-82
289540938 292 zinc-mediated transcriptional activator 0.993 0.554 0.870 1e-81
>gi|356516937|ref|XP_003527148.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
 Score =  326 bits (835), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 159/163 (97%)

Query: 1   MAKPKAPRRTLESYTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVH 60
           MAKPKAPRRTLESY+VK ISKTI+ GDC+LMRPS+PSKPSYVA+IERIE+DARGANVK+H
Sbjct: 1   MAKPKAPRRTLESYSVKHISKTIRAGDCILMRPSDPSKPSYVARIERIEADARGANVKIH 60

Query: 61  VRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDF 120
           VRWYYRPEESIGGRRQFHGSKEVFLSDH D+QSADTIE KCTVHSFKSYTKLDAVGNDDF
Sbjct: 61  VRWYYRPEESIGGRRQFHGSKEVFLSDHFDVQSADTIEAKCTVHSFKSYTKLDAVGNDDF 120

Query: 121 FCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSDW 163
           FCRFEYNSS+GAFNPDRVAVYCKCEMPYNPDDLMVQCEGC+DW
Sbjct: 121 FCRFEYNSSTGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCTDW 163

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255543795|ref|XP_002512960.1| phd finger transcription factor, putative [Ricinus communis] gi|223547971|gb|EEF49463.1| phd finger transcription factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351726182|ref|NP_001236094.1| uncharacterized protein LOC100526926 [Glycine max] gi|255631163|gb|ACU15947.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449461597|ref|XP_004148528.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Cucumis sativus] gi|449516389|ref|XP_004165229.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224077882|ref|XP_002305450.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] gi|222848414|gb|EEE85961.1| ebs-bah-phd domain-containing protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224105329|ref|XP_002313771.1| predicted protein [Populus trichocarpa] gi|222850179|gb|EEE87726.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297744763|emb|CBI38025.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225427692|ref|XP_002263493.1| PREDICTED: chromatin structure-remodeling complex subunit RSC1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357467401|ref|XP_003603985.1| Ebs-bah-phd domain-containing protein [Medicago truncatula] gi|355493033|gb|AES74236.1| Ebs-bah-phd domain-containing protein [Medicago truncatula] gi|388498190|gb|AFK37161.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|289540938|gb|ADD09609.1| zinc-mediated transcriptional activator [Trifolium repens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query163
TAIR|locus:2120252228 SHL1 "short life" [Arabidopsis 1.0 0.714 0.779 1.3e-70
TAIR|locus:2120693234 EBS "EARLY BOLTING IN SHORT DA 0.987 0.688 0.703 9.4e-66
TAIR|locus:2137256193 AT4G04260 [Arabidopsis thalian 0.754 0.637 0.677 7.1e-45
UNIPROTKB|F1NFN2473 BAHD1 "Uncharacterized protein 0.631 0.217 0.373 1e-10
UNIPROTKB|F1PKB9776 BAHD1 "Uncharacterized protein 0.631 0.132 0.383 3.7e-10
UNIPROTKB|F1M0741123 F1M074 "Uncharacterized protei 0.650 0.094 0.333 1.2e-09
MGI|MGI:2139371772 Bahd1 "bromo adjacent homology 0.631 0.133 0.381 2e-09
RGD|1563127772 Bahd1 "bromo adjacent homology 0.631 0.133 0.381 2e-09
UNIPROTKB|F1SSR6778 BAHD1 "Uncharacterized protein 0.631 0.132 0.381 2.1e-09
UNIPROTKB|F1MSG4779 BAHD1 "Uncharacterized protein 0.631 0.132 0.381 2.1e-09
TAIR|locus:2120252 SHL1 "short life" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 715 (256.8 bits), Expect = 1.3e-70, P = 1.3e-70
 Identities = 127/163 (77%), Positives = 145/163 (88%)

Query:     1 MAKPKAPRRTLESYTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVH 60
             M K KAPR+ L+SY +K I+K+I+ GD VLMR SEP KPSYVA++E IE+DARG++ KV 
Sbjct:     1 MPKQKAPRKQLKSYKLKHINKSIQEGDAVLMRSSEPGKPSYVARVEAIETDARGSHAKVR 60

Query:    61 VRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDF 120
             VRWYYRPEESIGGRRQFHG+KEVFLSDH D QSADTIEGKC VHSF SYTKLD+VGNDDF
Sbjct:    61 VRWYYRPEESIGGRRQFHGAKEVFLSDHFDFQSADTIEGKCKVHSFSSYTKLDSVGNDDF 120

Query:   121 FCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQCEGCSDW 163
             FCRFEYNS++GAF+PDRV V+CKCEMPYNPDDLMVQCE CS+W
Sbjct:   121 FCRFEYNSTTGAFDPDRVTVFCKCEMPYNPDDLMVQCEECSEW 163
GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009791 "post-embryonic development" evidence=IMP
GO:0006096 "glycolysis" evidence=RCA
GO:0006333 "chromatin assembly or disassembly" evidence=RCA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
GO:0048767 "root hair elongation" evidence=RCA
TAIR|locus:2120693 EBS "EARLY BOLTING IN SHORT DAYS" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137256 AT4G04260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NFN2 BAHD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PKB9 BAHD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1M074 F1M074 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2139371 Bahd1 "bromo adjacent homology domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1563127 Bahd1 "bromo adjacent homology domain containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SSR6 BAHD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MSG4 BAHD1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query163
cd04714121 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homolo 1e-47
smart00439121 smart00439, BAH, Bromo adjacent homology domain 8e-38
pfam01426120 pfam01426, BAH, BAH domain 1e-35
cd04370123 cd04370, BAH, BAH, or Bromo Adjacent Homology doma 7e-26
cd04717121 cd04717, BAH_polybromo, BAH, or Bromo Adjacent Hom 1e-17
cd04713146 cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homol 3e-12
cd04721130 cd04721, BAH_plant_1, BAH, or Bromo Adjacent Homol 4e-09
cd04718148 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homol 3e-08
cd04712130 cd04712, BAH_DCM_I, BAH, or Bromo Adjacent Homolog 4e-08
cd04709164 cd04709, BAH_MTA, BAH, or Bromo Adjacent Homology 5e-07
cd04710135 cd04710, BAH_fungalPHD, BAH, or Bromo Adjacent Hom 1e-06
cd04760124 cd04760, BAH_Dnmt1_I, BAH, or Bromo Adjacent Homol 3e-05
cd04720179 cd04720, BAH_Orc1p_Yeast, BAH, or Bromo Adjacent H 5e-05
cd04716122 cd04716, BAH_plantDCM_I, BAH, or Bromo Adjacent Ho 0.002
cd04719128 cd04719, BAH_Orc1p_animal, BAH, or Bromo Adjacent 0.002
>gnl|CDD|240065 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins Back     alignment and domain information 
 Score =  150 bits (380), Expect = 1e-47
 Identities = 54/136 (39%), Positives = 68/136 (50%), Gaps = 17/136 (12%)

Query: 22  TIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHGSK 81
            I+ GDCVL +        YVA+IE +  D  G N+ V V+WYYRPEE+ GGR+  HG K
Sbjct: 3   IIRVGDCVLFKSPGRPSLPYVARIESLWEDPEG-NMVVRVKWYYRPEETKGGRKPNHGEK 61

Query: 82  EVFLSDHHDIQSADTIEGKCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVY 141
           E+F SDH D  S  TIE KC V +F  Y +L  V                   P     +
Sbjct: 62  ELFASDHQDENSVQTIEHKCYVLTFAEYERLARVKK----------------KPQDGVDF 105

Query: 142 CKCEMPYNPDDLMVQC 157
             C   YNPD  M++C
Sbjct: 106 YYCAGTYNPDTGMLKC 121

BAHCC1 stands for BAH domain and coiled-coil containing 1. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions. Length = 121
>gnl|CDD|214664 smart00439, BAH, Bromo adjacent homology domain Back     alignment and domain information
>gnl|CDD|216495 pfam01426, BAH, BAH domain Back     alignment and domain information
>gnl|CDD|239835 cd04370, BAH, BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) Back     alignment and domain information
>gnl|CDD|240068 cd04717, BAH_polybromo, BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 Back     alignment and domain information
>gnl|CDD|240064 cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>gnl|CDD|240072 cd04721, BAH_plant_1, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>gnl|CDD|240069 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>gnl|CDD|240063 cd04712, BAH_DCM_I, BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 Back     alignment and domain information
>gnl|CDD|240060 cd04709, BAH_MTA, BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins Back     alignment and domain information
>gnl|CDD|240061 cd04710, BAH_fungalPHD, BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains Back     alignment and domain information
>gnl|CDD|240107 cd04760, BAH_Dnmt1_I, BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>gnl|CDD|240071 cd04720, BAH_Orc1p_Yeast, BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p Back     alignment and domain information
>gnl|CDD|240067 cd04716, BAH_plantDCM_I, BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>gnl|CDD|240070 cd04719, BAH_Orc1p_animal, BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 163
cd04714121 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, 100.0
cd04713146 BAH_plant_3 BAH, or Bromo Adjacent Homology domain 100.0
cd04717121 BAH_polybromo BAH, or Bromo Adjacent Homology doma 100.0
cd04716122 BAH_plantDCM_I BAH, or Bromo Adjacent Homology dom 100.0
PF01426119 BAH: BAH domain; InterPro: IPR001025 The BAH (brom 99.97
cd04370123 BAH BAH, or Bromo Adjacent Homology domain (also c 99.97
smart00439120 BAH Bromo adjacent homology domain. 99.97
cd04709164 BAH_MTA BAH, or Bromo Adjacent Homology domain, as 99.97
cd04721130 BAH_plant_1 BAH, or Bromo Adjacent Homology domain 99.97
cd04715159 BAH_Orc1p_like BAH, or Bromo Adjacent Homology dom 99.96
cd04710135 BAH_fungalPHD BAH, or Bromo Adjacent Homology doma 99.96
cd04760124 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain 99.95
cd04708202 BAH_plantDCM_II BAH, or Bromo Adjacent Homology do 99.95
cd04712130 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, 99.95
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 99.95
cd04720179 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology do 99.94
cd04719128 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology d 99.92
KOG1886 464 consensus BAH domain proteins [Transcription] 99.91
cd04711137 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domai 99.89
KOG1827 629 consensus Chromatin remodeling complex RSC, subuni 99.74
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 99.11
KOG1632 345 consensus Uncharacterized PHD Zn-finger protein [G 94.91
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 94.22
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 94.0
PTZ00112 1164 origin recognition complex 1 protein; Provisional 93.21
PF0992653 DUF2158: Uncharacterized small protein (DUF2158); 92.22
COG5076371 Transcription factor involved in chromatin remodel 91.75
PRK1070862 hypothetical protein; Provisional 90.49
PF1078162 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSR 90.28
PF10383139 Clr2: Transcription-silencing protein Clr2 ; Inter 90.1
PF1130275 DUF3104: Protein of unknown function (DUF3104); In 88.08
cd0583483 HDGF_related The PWWP domain is an essential part 87.84
PF0894058 DUF1918: Domain of unknown function (DUF1918); Int 87.37
cd0583587 Dnmt3b_related The PWWP domain is an essential com 86.72
cd0608080 MUM1_like Mutated melanoma-associated antigen 1 (M 84.41
KOG2752 345 consensus Uncharacterized conserved protein, conta 82.66
PF07154150 DUF1392: Protein of unknown function (DUF1392); In 80.09
>cd04714 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins Back     alignment and domain information 
Probab=100.00  E-value=1.8e-36  Score=212.59  Aligned_cols=121  Identities=44%  Similarity=0.813  Sum_probs=110.0

Q ss_pred             CcEEccCCEEEEecCCCCCCCeEEEEeEEEecCCCCeEEEEEEEeecccccCCcccccCCCceeEEeccccccccccEee
Q 031243           20 SKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIGGRRQFHGSKEVFLSDHHDIQSADTIEG   99 (163)
Q Consensus        20 ~~~~~vGD~V~v~~~~~~~~~~i~~I~~i~~~~~g~~~~v~v~Wfyrp~e~~~~~~~~~~~~Elf~s~~~d~~~~~~I~g   99 (163)
                      |++|++||+|+|.+++++.++|||+|++||++.+|+ ++++|+|||||+||.++++..++++|||+|++.|.+|+++|.|
T Consensus         1 ~~~~~vGD~V~v~~~~~~~~pyIgrI~~i~e~~~g~-~~~~v~WfyrPeEt~~~~~~~~~~~EvF~S~~~d~~~~~~I~g   79 (121)
T cd04714           1 KEIIRVGDCVLFKSPGRPSLPYVARIESLWEDPEGN-MVVRVKWYYRPEETKGGRKPNHGEKELFASDHQDENSVQTIEH   79 (121)
T ss_pred             CCEEEcCCEEEEeCCCCCCCCEEEEEEEEEEcCCCC-EEEEEEEEEcHHHccCcccccCCCCceEecCCcccccHHHhCc
Confidence            359999999999998755789999999999998888 9999999999999999988778999999999999999999999


Q ss_pred             ecEEEecccccccCCCCCCeEEEeeeeecCCCcccCCCCceEEeeCCCCCCCcceeeC
Q 031243          100 KCTVHSFKSYTKLDAVGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDLMVQC  157 (163)
Q Consensus       100 kc~V~~~~~~~~~~~~~~~~ffcr~~yd~~~~~f~p~~~~~~C~C~~~~npd~~~~~C  157 (163)
                      ||.|+++.+|.++.+..+                .+..+..+|+|..++||++.||||
T Consensus        80 kc~V~~~~ey~~~~~~~~----------------~~~~~~d~~~Ce~~yn~~~~~~~c  121 (121)
T cd04714          80 KCYVLTFAEYERLARVKK----------------KPQDGVDFYYCAGTYNPDTGMLKC  121 (121)
T ss_pred             ccEEEehhHheecccccC----------------CCCcCCCEEEEeccCCCCcCcccC
Confidence            999999999988765322                555788999999999999999999

BAHCC1 stands for BAH domain and coiled-coil containing 1. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.
>cd04713 BAH_plant_3 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>cd04717 BAH_polybromo BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2 Back     alignment and domain information
>cd04716 BAH_plantDCM_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>PF01426 BAH: BAH domain; InterPro: IPR001025 The BAH (bromo-adjacent homology) family contains proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 from INTERPRO, the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation Back     alignment and domain information
>cd04370 BAH BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif) Back     alignment and domain information
>smart00439 BAH Bromo adjacent homology domain Back     alignment and domain information
>cd04709 BAH_MTA BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins Back     alignment and domain information
>cd04721 BAH_plant_1 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>cd04715 BAH_Orc1p_like BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins Back     alignment and domain information
>cd04710 BAH_fungalPHD BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains Back     alignment and domain information
>cd04760 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>cd04708 BAH_plantDCM_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants Back     alignment and domain information
>cd04712 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1 Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>cd04720 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p Back     alignment and domain information
>cd04719 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p Back     alignment and domain information
>KOG1886 consensus BAH domain proteins [Transcription] Back     alignment and domain information
>cd04711 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins Back     alignment and domain information
>KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1632 consensus Uncharacterized PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PF09926 DUF2158: Uncharacterized small protein (DUF2158); InterPro: IPR019226 This entry represents a family of predominantly prokaryotic proteins with no known function Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PRK10708 hypothetical protein; Provisional Back     alignment and domain information
>PF10781 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSRB is a novel dextransucrase which produces a dextran different from the typical dextran, as it contains (1-6) and (1-2) linkages, when this strain is grown in the presence of sucrose [] Back     alignment and domain information
>PF10383 Clr2: Transcription-silencing protein Clr2 ; InterPro: IPR018839 Clr2 (cryptic loci regulator) is a chromatin silencing protein, one of a quartet of proteins forming the core of SHREC, a multienzyme effector complex that mediates hetero-chromatic transcriptional gene silencing in fission yeast [] Back     alignment and domain information
>PF11302 DUF3104: Protein of unknown function (DUF3104); InterPro: IPR021453 This family of proteins with unknown function appears to be restricted to Cyanobacteria Back     alignment and domain information
>cd05834 HDGF_related The PWWP domain is an essential part of the Hepatoma Derived Growth Factor (HDGF) family of proteins, and is necessary for DNA binding by HDGF Back     alignment and domain information
>PF08940 DUF1918: Domain of unknown function (DUF1918); InterPro: IPR015035 This domain is found in various hypothetical bacterial proteins, and has no known function Back     alignment and domain information
>cd05835 Dnmt3b_related The PWWP domain is an essential component of DNA methyltransferase 3 B (Dnmt3b) which is responsible for establishing DNA methylation patterns during embryogenesis and gametogenesis Back     alignment and domain information
>cd06080 MUM1_like Mutated melanoma-associated antigen 1 (MUM-1) is a melanoma-associated antigen (MAA) Back     alignment and domain information
>KOG2752 consensus Uncharacterized conserved protein, contains N-recognin-type Zn-finger [General function prediction only] Back     alignment and domain information
>PF07154 DUF1392: Protein of unknown function (DUF1392); InterPro: IPR009824 This family consists of several hypothetical cyanobacterial proteins of around 150 residues in length, which seem to be specific to Anabaena species Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query163
1w4s_A174 Crystal Structure Of The Proximal Bah Domain Of Pol 4e-08

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query163
1w4s_A174 Polybromo, polybromo 1 protein; BAH, bromo-associa 2e-45
4dov_A163 ORC1, origin recognition complex subunit 1; DNA re 2e-21
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 9e-16
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 6e-11
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 1e-15
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 5e-12
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 5e-11
3kv5_D 488 JMJC domain-containing histone demethylation prote 4e-09
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 5e-09
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 1e-08
2fl7_A232 Regulatory protein SIR3; ORC, silencing, chromatin 2e-07
1wem_A76 Death associated transcription factor 1; structura 9e-07
3o70_A68 PHD finger protein 13; PHF13, structural genomics 2e-05
1wee_A72 PHD finger family protein; structural genomics, PH 3e-05
1m4z_A238 Origin recognition complex subunit 1; DNA replicat 1e-04
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 1e-04
1we9_A64 PHD finger family protein; structural genomics, PH 3e-04
>4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Length = 163 Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002 Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 Back     alignment and structure
>2fl7_A Regulatory protein SIR3; ORC, silencing, chromatin, transcription; 1.85A {Saccharomyces cerevisiae} PDB: 2fvu_A 3tu4_K* Length = 232 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 Back     alignment and structure
>1m4z_A Origin recognition complex subunit 1; DNA replication, transcriptional silencing, chromatin, BAH D gene regulation; 2.20A {Saccharomyces cerevisiae} SCOP: b.34.12.1 PDB: 1zhi_A 1zbx_A Length = 238 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query163
1w4s_A174 Polybromo, polybromo 1 protein; BAH, bromo-associa 100.0
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 99.96
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 99.94
4dov_A163 ORC1, origin recognition complex subunit 1; DNA re 99.93
4ft4_B 784 DNA (cytosine-5)-methyltransferase 1; chromodomain 99.88
3swr_A 1002 DNA (cytosine-5)-methyltransferase 1; epigenetics, 99.88
3av4_A 1330 DNA (cytosine-5)-methyltransferase 1; CXXC-type zi 99.85
2fl7_A232 Regulatory protein SIR3; ORC, silencing, chromatin 99.7
1m4z_A238 Origin recognition complex subunit 1; DNA replicat 99.7
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 98.15
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 97.71
1we9_A64 PHD finger family protein; structural genomics, PH 97.53
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 97.47
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 97.47
1wee_A72 PHD finger family protein; structural genomics, PH 97.31
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 97.22
1wem_A76 Death associated transcription factor 1; structura 97.05
3o70_A68 PHD finger protein 13; PHF13, structural genomics 97.04
3kv5_D 488 JMJC domain-containing histone demethylation prote 96.6
1wew_A78 DNA-binding family protein; structural genomics, P 96.3
2k16_A75 Transcription initiation factor TFIID subunit 3; p 94.78
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 94.29
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 93.75
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 93.61
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 93.29
1weu_A91 Inhibitor of growth family, member 4; structural g 93.28
2l7p_A100 Histone-lysine N-methyltransferase ASHH2; CW-domai 92.82
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 92.81
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 92.75
1x4i_A70 Inhibitor of growth protein 3; structural genomics 92.57
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 92.35
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 87.81
2e61_A69 Zinc finger CW-type PWWP domain protein 1; ZF-CW d 85.96
2a7y_A83 Hypothetical protein RV2302/MT2359; anti-parallel 80.86
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Back     alignment and structure
>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A* Back     alignment and structure
>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Back     alignment and structure
>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Back     alignment and structure
>2fl7_A Regulatory protein SIR3; ORC, silencing, chromatin, transcription; 1.85A {Saccharomyces cerevisiae} PDB: 2fvu_A 3tu4_K* Back     alignment and structure
>1m4z_A Origin recognition complex subunit 1; DNA replication, transcriptional silencing, chromatin, BAH D gene regulation; 2.20A {Saccharomyces cerevisiae} SCOP: b.34.12.1 PDB: 1zhi_A 1zbx_A Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2l7p_A Histone-lysine N-methyltransferase ASHH2; CW-domain; NMR {Arabidopsis thaliana} Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>2e61_A Zinc finger CW-type PWWP domain protein 1; ZF-CW domain, structural genomics, NPPSFA, national project protein structural and functional analyses; NMR {Homo sapiens} PDB: 2rr4_A* Back     alignment and structure
>2a7y_A Hypothetical protein RV2302/MT2359; anti-parallel beta sheet, structural genomics, PSI, protein structure initiative; NMR {Mycobacterium tuberculosis} SCOP: b.34.6.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 163
d1m4za_217 b.34.12.1 (A:) Origin-recognition complex protein 1e-24
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 5e-09
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 2e-05
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 8e-04
>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 217 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: BAH domain
family: BAH domain
domain: Origin-recognition complex protein 120kDa subunit, Orc1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 92.7 bits (230), Expect = 1e-24
 Identities = 18/157 (11%), Positives = 31/157 (19%), Gaps = 26/157 (16%)

Query: 22  TIKPGDCVLMRPSEPSKPSYVAKIERI----------------------ESDARGANVKV 59
            +  GD V+M          V  I+ +                         A       
Sbjct: 52  KLGRGDSVVMHNEAAGTY-SVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNP 110

Query: 60  HVRWYYRPEESIGGRRQFH-GSKEVFLSDHHDIQSADTIEGKCTVHSFKSY--TKLDAVG 116
                 RP               E++L+                V     +   K +   
Sbjct: 111 DANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDP 170

Query: 117 NDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPYNPDDL 153
             DF  R+    +   F    +           P + 
Sbjct: 171 ERDFTVRYICEPTGEKFVDINIEDVKAYIKKVEPREA 207
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query163
d1m4za_217 Origin-recognition complex protein 120kDa subunit, 99.89
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 97.94
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 96.99
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 96.27
d1wema_76 Death associated transcription factor 1, Datf1 (DI 96.26
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 92.28
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 92.24
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 91.78
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 90.39
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 88.11
d2a7ya180 Hypothetical protein Rv2302/MT2359 {Mycobacterium 84.93
d1nppa258 N-utilization substance G protein NusG, C-terminal 83.59
>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: BAH domain
family: BAH domain
domain: Origin-recognition complex protein 120kDa subunit, Orc1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.89  E-value=2.7e-24  Score=161.29  Aligned_cols=138  Identities=14%  Similarity=0.089  Sum_probs=113.0

Q ss_pred             EEEccCCcEEccCCEEEEecCCCCCCCeEEEEeEEEecCCCCeEEEEEEEeecccccCC---------------------
Q 031243           14 YTVKSISKTIKPGDCVLMRPSEPSKPSYVAKIERIESDARGANVKVHVRWYYRPEESIG---------------------   72 (163)
Q Consensus        14 ~~~~g~~~~~~vGD~V~v~~~~~~~~~~i~~I~~i~~~~~g~~~~v~v~Wfyrp~e~~~---------------------   72 (163)
                      +.....|.++++||+|+|++++. .++|||+|.+|..+..++....-+.||+|..|...                     
T Consensus        44 ~~r~~D~~e~~~GD~Vlvk~~~~-~~~~v~iI~ei~~~~~~~~~e~~~~~~lr~~e~~~~~~~~~~~~~~~w~~~p~e~~  122 (217)
T d1m4za_          44 LKRSSDGIKLGRGDSVVMHNEAA-GTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYY  122 (217)
T ss_dssp             EEETTTCCEECTTCEEEEEETTT-TEEEEEEEEEEEEETTTTEEEEEEEEEECGGGSCHHHHHHHHCHHHHHSCCCHHHH
T ss_pred             EEEecCCeEEecCCEEEEeCCCC-CCceEEEEeeeccCcccchheeeeecccchhhhccchhhhhcccceeeecCchhhh
Confidence            33343456999999999998874 68999999999998776656677777777766431                     


Q ss_pred             -c-ccccCCCceeEEeccccccccccEeeecEEEecccccccC--CCCCCeEEEeeeeecCCCcccCCCCceEEeeCCCC
Q 031243           73 -G-RRQFHGSKEVFLSDHHDIQSADTIEGKCTVHSFKSYTKLD--AVGNDDFFCRFEYNSSSGAFNPDRVAVYCKCEMPY  148 (163)
Q Consensus        73 -~-~~~~~~~~Elf~s~~~d~~~~~~I~gkc~V~~~~~~~~~~--~~~~~~ffcr~~yd~~~~~f~p~~~~~~C~C~~~~  148 (163)
                       . .+....+||||+|++.+.+++++|+|||.|++..+|....  ...+++||||+.||+..++|++..+...|.+.+..
T Consensus       123 ~~k~r~~~~~~ElflT~~~d~i~~~~I~~k~~V~s~~ef~~~~~~~~~~~~F~cr~~~D~~~~~f~~id~~~~~~~~~~~  202 (217)
T d1m4za_         123 NKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKV  202 (217)
T ss_dssp             HHHHHHHSCTTEEEEEEEEEEECGGGEEEEEEEECHHHHHHHGGGCCTTTEEEEEEECCTTSCCCEECCHHHHHHHHTTS
T ss_pred             hhccccccCcceeEecCccceeehhheeeeEEEecHHHhcchhhccCCCCeEEEEEEEcCCCCceeeccHHHhhhhcccc
Confidence             1 1123678999999999999999999999999999997543  35689999999999999999998888999999999


Q ss_pred             CCCc
Q 031243          149 NPDD  152 (163)
Q Consensus       149 npd~  152 (163)
                      ||+.
T Consensus       203 np~~  206 (217)
T d1m4za_         203 EPRE  206 (217)
T ss_dssp             CHHH
T ss_pred             ChHH
Confidence            9875
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a7ya1 b.34.6.3 (A:1-80) Hypothetical protein Rv2302/MT2359 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nppa2 b.34.5.4 (A:191-248) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure