Citrus Sinensis ID: 031245

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MLIRQARNFSKAYAAPLSSSLKTLFPSPADVVPGVAADVADVTGADDLVYTEPPVSSTVKPAMEPSLLQPGVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTGMFSNIIHVSTIFWLCPYYILCT
ccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccHHHHHHHHHHcccccEEEEEcccHHHHHHHHHccccccccccEEEEEEccEEEEEEcHHHHHHHHHHcHHHHHHHHHHHcc
cHHHHHHHccHcccccccHHHHHccccccccHHHHHHHHHcccHHHHHcccccccccccccccccccccccEEEEccccHHccHHHEEEEEccccccEEEEEcccHHHHHHHHHccccHHccccEEEEEccccEEEHHHHHHHHHHHHHccHHEEcccEEccc
MLIRQARNFSKayaaplssslktlfpspadvvpgvaadvadvtgaddlvyteppvsstvkpamepsllqpgvviydgvchlchggvKWVIRADKYRKIKFcclqsqaaepylrlcgldrEDVLRRFLfvegpglyhqastgmfsniIHVSTIFWlcpyyilct
mlirqarnFSKAYAAPLSSSLKTLFPSPADVVPGVAADVADVTGADDLVYTEPPVSSTVKPAMEPSLLQPGVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTGMFSNIIHVSTIFWLCPYYILCT
MLIRQARNFSKAYAAPLSSSLKTLFPSpadvvpgvaadvadvtgaddLVYTEPPVSSTVKPAMEPSLLQPGVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTGMFSNIIHVSTIFWLCPYYILCT
***********************LF**PADVVPGVAADVADVTGADDLVYTE*************SLLQPGVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTGMFSNIIHVSTIFWLCPYYILC*
****************************ADV************************************LQPGVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTGMFSNIIHVSTIFWLCPYYILCT
********FSKAYAAPLSSSLKTLFPSPADVVPGVAADVADVTGADDLVYTEPPVSSTVKPAMEPSLLQPGVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTGMFSNIIHVSTIFWLCPYYILCT
********************************************************STVKPAMEPSLLQPGVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTGMFSNIIHVSTIFWLCPYYILCT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIRQARNFSKAYAAPLSSSLKTLFPSPADVVPGVAADVADVTGADDLVYTEPPVSSTVKPAMEPSLLQPGVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTGMFSNIIHVSTIFWLCPYYILCT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query163 2.2.26 [Sep-21-2011]
P40761137 Uncharacterized protein Y yes no 0.417 0.496 0.356 2e-06
Q9SSR1172 DCC family protein At1g52 no no 0.312 0.296 0.431 2e-06
>sp|P40761|YUXK_BACSU Uncharacterized protein YuxK OS=Bacillus subtilis (strain 168) GN=yuxK PE=3 SV=1 Back     alignment and function desciption
 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 45/73 (61%), Gaps = 5/73 (6%)

Query: 72  VVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGL--DREDVLRRFLFV 129
           V+++DGVC+LC+G V+++I+ D    I F  LQS+  +  L+  GL  DR D    F+F+
Sbjct: 10  VLLFDGVCNLCNGAVQFIIKRDPDGLISFTSLQSETGQSLLKKSGLPTDRFD---SFVFI 66

Query: 130 EGPGLYHQASTGM 142
           E   +Y +++  +
Sbjct: 67  EDGQVYTKSTAAI 79

Bacillus subtilis (strain 168) (taxid: 224308)
>sp|Q9SSR1|Y1259_ARATH DCC family protein At1g52590, chloroplastic OS=Arabidopsis thaliana GN=At1g52590 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query163
255588184213 conserved hypothetical protein [Ricinus 0.656 0.502 0.692 1e-37
224099711208 predicted protein [Populus trichocarpa] 0.595 0.466 0.74 2e-35
118482345220 unknown [Populus trichocarpa] 0.595 0.440 0.74 3e-35
297845448 536 RNase H domain-containing protein [Arabi 0.711 0.216 0.594 6e-35
334182808213 Putative thiol-disulfide oxidoreductase 0.711 0.544 0.586 2e-33
171921105 492 RNase H domain-containing protein [Brass 0.680 0.225 0.594 2e-33
359473412 453 PREDICTED: uncharacterized protein LOC10 0.730 0.262 0.598 7e-33
296086506216 unnamed protein product [Vitis vinifera] 0.828 0.625 0.559 1e-32
147777969224 hypothetical protein VITISV_018709 [Viti 0.963 0.700 0.505 1e-32
449434879242 PREDICTED: uncharacterized protein YuxK- 0.674 0.454 0.615 6e-32
>gi|255588184|ref|XP_002534526.1| conserved hypothetical protein [Ricinus communis] gi|223525107|gb|EEF27856.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  160 bits (406), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 89/114 (78%), Gaps = 7/114 (6%)

Query: 28  PADVVPGVAADVADVTGADDLVYTEPPVSSTVKPAMEPSLLQPGVVIYDGVCHLCHGGVK 87
           P D V   AADVA      +++Y  P  S+   P   P+LLQP VV+YDGVCHLCH GVK
Sbjct: 40  PIDTVSETAADVAG-----EVLY--PDASTLPSPVTLPTLLQPRVVVYDGVCHLCHRGVK 92

Query: 88  WVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTG 141
           WVI+ADKYRKIKFCCLQS+AAEPYLRLCGLDR+DVLRRFLF+EGP LYHQAST 
Sbjct: 93  WVIKADKYRKIKFCCLQSKAAEPYLRLCGLDRDDVLRRFLFIEGPDLYHQASTA 146

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224099711|ref|XP_002311587.1| predicted protein [Populus trichocarpa] gi|222851407|gb|EEE88954.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118482345|gb|ABK93096.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297845448|ref|XP_002890605.1| RNase H domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297336447|gb|EFH66864.1| RNase H domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|334182808|ref|NP_001185076.1| Putative thiol-disulfide oxidoreductase DCC [Arabidopsis thaliana] gi|9369400|gb|AAF87148.1|AC002423_13 T23E23.25 [Arabidopsis thaliana] gi|332192356|gb|AEE30477.1| Putative thiol-disulfide oxidoreductase DCC [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|171921105|gb|ACB59203.1| RNase H domain-containing protein [Brassica oleracea] Back     alignment and taxonomy information
>gi|359473412|ref|XP_002266599.2| PREDICTED: uncharacterized protein LOC100255243 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296086506|emb|CBI32095.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147777969|emb|CAN65134.1| hypothetical protein VITISV_018709 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449434879|ref|XP_004135223.1| PREDICTED: uncharacterized protein YuxK-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query163
UNIPROTKB|Q87WV7150 PSPTO_4436 "Uncharacterized pr 0.466 0.506 0.380 1.4e-07
UNIPROTKB|Q48N48122 PSPPH_0898 "Uncharacterized pr 0.374 0.5 0.375 1.8e-07
TAIR|locus:2035159172 AT1G52590 "AT1G52590" [Arabido 0.312 0.296 0.431 4.8e-07
UNIPROTKB|Q87WV7 PSPTO_4436 "Uncharacterized protein" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] Back     alignment and assigned GO terms
 Score = 120 (47.3 bits), Expect = 1.4e-07, P = 1.4e-07
 Identities = 32/84 (38%), Positives = 47/84 (55%)

Query:    56 SSTVKPAMEPSLLQPG--VVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLR 113
             S+T +P   P  L+ G  VV++DGVC LC+G  K++IR D+ ++I+   +QS   +  L 
Sbjct:     3 SNTPQPNPAP-FLKAGETVVLFDGVCKLCNGWAKFIIRHDRRQRIRLATVQSPEGQALLE 61

Query:   114 LCGL--DREDVLRRFLFVEGPGLY 135
               GL  DR D +     V G  LY
Sbjct:    62 WAGLPLDRFDTMAA---VTGDRLY 82
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
UNIPROTKB|Q48N48 PSPPH_0898 "Uncharacterized protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
TAIR|locus:2035159 AT1G52590 "AT1G52590" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query163
pfam04134113 pfam04134, DUF393, Protein of unknown function, DU 2e-15
COG3011137 COG3011, COG3011, Predicted thiol-disulfide oxidor 5e-12
>gnl|CDD|217918 pfam04134, DUF393, Protein of unknown function, DUF393 Back     alignment and domain information 
 Score = 67.7 bits (166), Expect = 2e-15
 Identities = 21/64 (32%), Positives = 36/64 (56%)

Query: 73  VIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGP 132
           V+YDG C LC+  V+++ R D+  +++F  +QS   +  L   G+D ED+  R    +G 
Sbjct: 1   VLYDGECPLCNREVRFLERRDRGGRLRFVDIQSAEGQALLEAFGIDPEDLDSRLHVEDGG 60

Query: 133 GLYH 136
            +Y 
Sbjct: 61  DVYT 64

Members of this family have two highly conserved cysteine residues near their N-terminus. The function of these proteins is unknown. Length = 113
>gnl|CDD|225556 COG3011, COG3011, Predicted thiol-disulfide oxidoreductase [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 163
COG3011137 Predicted thiol-disulfide oxidoreductase [General 99.9
PF04134114 DUF393: Protein of unknown function, DUF393; Inter 99.83
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 94.65
PF13728215 TraF: F plasmid transfer operon protein 93.97
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 93.81
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 92.0
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 91.25
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 91.13
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 90.9
TIGR02739256 TraF type-F conjugative transfer system pilin asse 90.68
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 89.75
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 89.56
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 89.45
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 89.32
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 89.16
PRK1120085 grxA glutaredoxin 1; Provisional 88.99
COG3019149 Predicted metal-binding protein [General function 88.61
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 88.52
PRK1063883 glutaredoxin 3; Provisional 88.47
PTZ0005198 thioredoxin; Provisional 87.91
PRK13703248 conjugal pilus assembly protein TraF; Provisional 87.75
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 87.38
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 87.37
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 87.34
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 87.18
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 87.11
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 86.78
TIGR02740271 TraF-like TraF-like protein. This protein is relat 86.53
cd0294793 TRX_family TRX family; composed of two groups: Gro 85.96
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 85.84
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 85.83
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 85.57
PRK10877232 protein disulfide isomerase II DsbC; Provisional 85.47
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 85.39
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 84.81
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 84.7
PRK11657251 dsbG disulfide isomerase/thiol-disulfide oxidase; 84.39
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 84.22
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 83.84
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 83.43
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 83.33
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 82.55
PRK03147173 thiol-disulfide oxidoreductase; Provisional 82.54
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 82.38
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 82.32
cd0297298 DsbA_family DsbA family; consists of DsbA and DsbA 81.91
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 81.8
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 81.68
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 80.6
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 80.58
>COG3011 Predicted thiol-disulfide oxidoreductase [General function prediction only] Back     alignment and domain information 
Probab=99.90  E-value=1.2e-23  Score=163.76  Aligned_cols=90  Identities=37%  Similarity=0.637  Sum_probs=83.1

Q ss_pred             CcEEEEcCCCcchHHHHHHHHHhcCCCcEEEEEcCCccchhhHHhCCCCHhhhhccEEEEECCCeEEEehHHHHHHHHHc
Q 031245           70 PGVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTGMFSNIIHV  149 (163)
Q Consensus        70 ~~vV~YDG~C~LC~~~V~fl~r~Dr~~r~~Fv~lQs~~g~~lL~~~Gl~~e~~~~sillvd~~Gr~y~gSdAvl~Il~~L  149 (163)
                      ..+|+|||+|+||+++|+|++++|+.++++|+++|++.|++.++.+|++.++. ++++++++ |+.+.||||++++++.|
T Consensus         9 ~~vvlyDG~C~lC~~~vrfLi~~D~~~~i~f~~~q~e~g~~~l~~~~l~~~~~-~s~~~~~~-g~~~~~sdA~~~i~~~L   86 (137)
T COG3011           9 DLVVLYDGVCPLCDGWVRFLIRRDQGGRIRFAALQSEPGQALLEAAGLDPEDV-DSVLLVEA-GQLLVGSDAAIRILRLL   86 (137)
T ss_pred             CEEEEECCcchhHHHHHHHHHHhccCCcEEEEeccCchhhhHHhhcCCChhhh-heeeEecC-CceEeccHHHHHHHHHC
Confidence            36999999999999999999999999999999999999999999999999986 78988886 78999999999999999


Q ss_pred             cccc------cccccccc
Q 031245          150 STIF------WLCPYYIL  161 (163)
Q Consensus       150 ~~~w------~l~P~~i~  161 (163)
                      +.+|      |++|++||
T Consensus        87 ~~~Wr~~~~~~~lp~plr  104 (137)
T COG3011          87 PGPWRLLVWLWILPRPLR  104 (137)
T ss_pred             CcceeeeehhhccchHHH
Confidence            9877      56787775

>PF04134 DUF393: Protein of unknown function, DUF393; InterPro: IPR007263 The DCC family, named after the conserved N-terminal DxxCxxC motif, encompasses COG3011 from COG Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>COG3019 Predicted metal-binding protein [General function prediction only] Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query163
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 95.66
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 94.58
2lrn_A152 Thiol:disulfide interchange protein; structural ge 93.98
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 93.82
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 93.81
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 93.74
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 93.71
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 93.51
2l57_A126 Uncharacterized protein; structural genomics, unkn 93.49
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 93.25
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 93.21
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 93.01
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 92.9
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 92.85
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 92.76
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 92.72
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 92.66
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 92.63
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 92.54
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 92.53
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 92.47
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 92.24
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 92.23
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 92.14
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 92.12
2l5l_A136 Thioredoxin; structural genomics, electron transpo 91.96
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 91.95
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 91.81
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 91.67
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 91.56
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 91.14
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 91.08
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 91.0
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 90.99
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 90.99
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 90.97
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 90.74
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 90.52
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 90.48
2lrt_A152 Uncharacterized protein; structural genomics, thio 90.3
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 90.19
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 90.08
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 90.04
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 90.03
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 90.01
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 89.92
3raz_A151 Thioredoxin-related protein; structural genomics, 89.89
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 89.69
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 89.64
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 89.61
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 89.5
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 89.45
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 89.4
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 89.34
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 89.31
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 89.3
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 89.26
2yzu_A109 Thioredoxin; redox protein, electron transport, st 89.25
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 89.21
4f03_A 253 Glutathione transferase; GST fold; 1.80A {Phaneroc 88.79
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 88.76
2l5o_A153 Putative thioredoxin; structural genomics, unknown 88.72
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 88.71
4evm_A138 Thioredoxin family protein; structural genomics, n 88.69
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 88.62
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 88.57
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 88.49
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 88.46
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 88.45
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 88.25
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 88.16
2kuc_A130 Putative disulphide-isomerase; structural genomics 87.98
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 87.72
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 87.63
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 87.59
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 87.36
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 87.28
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 87.2
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 87.17
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 87.1
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 86.98
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 86.9
2ywi_A196 Hypothetical conserved protein; uncharacterized co 86.85
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 86.69
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 86.58
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 86.57
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 86.51
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 86.5
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 86.49
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 86.46
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 86.37
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 86.33
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 86.26
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 85.92
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 85.85
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 85.81
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 85.78
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 85.72
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 85.64
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 85.53
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 85.5
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 85.48
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 85.43
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 85.37
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 85.35
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 85.35
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 85.23
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 85.21
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 85.13
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 85.04
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 84.93
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 84.82
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 84.47
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 84.17
4euy_A105 Uncharacterized protein; structural genomics, PSI- 84.07
2jsy_A167 Probable thiol peroxidase; solution structure, ant 83.91
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 83.86
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 83.68
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 83.64
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 83.62
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 83.61
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 83.59
1kte_A105 Thioltransferase; redox-active center, electron tr 83.57
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 83.44
1a8l_A 226 Protein disulfide oxidoreductase; PDI, thioredoxin 83.26
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 83.18
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 83.18
3gv1_A147 Disulfide interchange protein; neisseria gonorrhoe 82.94
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 82.48
4glt_A 225 Glutathione S-transferase-like protein; structural 82.13
3tdg_A273 DSBG, putative uncharacterized protein; thioredoxi 81.64
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 81.4
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 81.35
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 82.25
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 81.08
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 80.53
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 80.47
1psq_A163 Probable thiol peroxidase; structural genomics, NY 80.32
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
Probab=95.66  E-value=0.018  Score=37.77  Aligned_cols=74  Identities=12%  Similarity=0.086  Sum_probs=47.1

Q ss_pred             CCcEEEEcCCCcchHHHHHHHHHhcCCCcEEEEEcCCccc----hhhHHhCCC---CHhhhhccEEEEECCCeEEEehHH
Q 031245           69 QPGVVIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAA----EPYLRLCGL---DREDVLRRFLFVEGPGLYHQASTG  141 (163)
Q Consensus        69 ~~~vV~YDG~C~LC~~~V~fl~r~Dr~~r~~Fv~lQs~~g----~~lL~~~Gl---~~e~~~~sillvd~~Gr~y~gSdA  141 (163)
                      ++.+||.--.|+.|.+...++.++..  .+.+..+.-...    +++.+..|.   ....+.  .+++  +|+...|++.
T Consensus         4 m~v~ly~~~~Cp~C~~~~~~L~~~~i--~~~~~~vd~~~~~~~~~el~~~~g~~~~~~~~vP--~i~i--~g~~i~g~~~   77 (89)
T 3msz_A            4 MKVKIYTRNGCPYCVWAKQWFEENNI--AFDETIIDDYAQRSKFYDEMNQSGKVIFPISTVP--QIFI--DDEHIGGFTE   77 (89)
T ss_dssp             CCEEEEECTTCHHHHHHHHHHHHTTC--CCEEEECCSHHHHHHHHHHHHTTTCCSSCCCSSC--EEEE--TTEEEESHHH
T ss_pred             eEEEEEEcCCChhHHHHHHHHHHcCC--CceEEEeecCCChhHHHHHHHHhCCCCCCCCccC--EEEE--CCEEEeChHH
Confidence            35667777899999999999987654  456665533221    344455554   111221  2344  5788999999


Q ss_pred             HHHHHHH
Q 031245          142 MFSNIIH  148 (163)
Q Consensus       142 vl~Il~~  148 (163)
                      +.+.+..
T Consensus        78 i~~~~~~   84 (89)
T 3msz_A           78 LKANADK   84 (89)
T ss_dssp             HHHTHHH
T ss_pred             HHHHHHH
Confidence            9887764
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>3tdg_A DSBG, putative uncharacterized protein; thioredoxin fold, reductase, oxidoreductase; HET: P6G; 2.10A {Helicobacter pylori} Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query163
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 89.98
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 89.69
d1wjka_100 Thioredoxin-like structure containing protein C330 89.46
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 88.41
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 87.23
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 85.7
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 85.4
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 84.93
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 84.57
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 84.24
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 83.97
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 83.54
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 82.5
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 80.88
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 80.81
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 80.58
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 80.46
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 80.34
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione S-transferase (GST), N-terminal domain
domain: Glutaredoxin 2
species: Escherichia coli [TaxId: 562]

Probab=89.98  E-value=1.4  Score=27.58  Aligned_cols=71  Identities=14%  Similarity=0.180  Sum_probs=45.5

Q ss_pred             EEEcCCCcchHHHHHHHHHhcCCCcEEEEEcCCccchhhHHhCCCCHhhhhccEEEEECCCeEEEehHHHHHHHHHcc
Q 031245           73 VIYDGVCHLCHGGVKWVIRADKYRKIKFCCLQSQAAEPYLRLCGLDREDVLRRFLFVEGPGLYHQASTGMFSNIIHVS  150 (163)
Q Consensus        73 V~YDG~C~LC~~~V~fl~r~Dr~~r~~Fv~lQs~~g~~lL~~~Gl~~e~~~~sillvd~~Gr~y~gSdAvl~Il~~L~  150 (163)
                      ++.-..||+|.+....+....-.  +....+.....+..++.-|.  ..+   =.++++||++...|.++++-+..+.
T Consensus         3 LY~~~~cP~~~rvr~~l~~kgi~--~e~~~~~~~~~~~~~~~~p~--~~V---P~L~~~dg~~i~eS~~I~~yLd~~~   73 (75)
T d1g7oa2           3 LYIYDHCPYCLKARMIFGLKNIP--VELHVLLNDDAETPTRMVGQ--KQV---PILQKDDSRYMPESMDIVHYVDKLD   73 (75)
T ss_dssp             EEECTTCHHHHHHHHHHHHHTCC--CEEEECCTTTTHHHHHHHSS--SCC---CEEEETTTEEEECHHHHHHHHHHHT
T ss_pred             EEccCCCCchHHHHHHHHHhCCC--cccccccccchHHHHHhCCC--Cce---EEEEEcCCCEEecHHHHHHHHHHhh
Confidence            66777899999999988877764  34444433333444433221  112   1345667999999999998776653
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure