Citrus Sinensis ID: 031249


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MFFSQESFFWSLLQAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLSSWLEDARQHANPNMSIMLVGNKCDLAHRRAVSKEEGEQFAKENGLLFLEASARTAQNVEEAFIKTAAKILQNIQEGALDAVNDQSGIKVGYGRGQGPSGARDGTVSQRGGCCS
cccccHHHccccccccHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccc
*FFSQESFFWSLLQAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLSSWLEDARQHANPNMSIMLVGNKCDLAHRRAVSKEEGEQFAKENGLLFLEASARTAQNVEEAFIKTAAKILQNIQEG*************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFFSQESFFWSLLQAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLSSWLEDARQHANPNMSIMLVGNKCDLAHRRAVSKEEGEQFAKENGLLFLEASARTAQNVEEAFIKTAAKILQNIQEGALDAVNDQSGIKVGYGRGQGPSGARDGTVSQRGGCCS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related protein Rab-2A Required for protein transport from the endoplasmic reticulum to the Golgi complex.probableQ01971
Ras-related protein RABB1b Intracellular vesicle trafficking and protein transport.probableQ38922
Ras-related protein Rab-2A Required for protein transport from the endoplasmic reticulum to the Golgi complex.probableP61105

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A5J, chain A
Confidence level:very confident
Coverage over the Query: 6-125
View the alignment between query and template
View the model in PyMOL
Template: 3BBP, chain A
Confidence level:very confident
Coverage over the Query: 15-119
View the alignment between query and template
View the model in PyMOL