Citrus Sinensis ID: 031251

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MGLSNIYEAVLFIVIISAVAVTSKEQLSTRECEDLGFTGLALCSDCNTFAEYVKDQELVADCLKCCTEDSDDSMSKITYSGAILEACMRKLVFYPEIVGFIEEEKDKFPTVRVQYVFNSPPKLIMLDEEGQHKETIRIDNWKREHMLQFLQEKVKPTSASAKI
cccHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccccccccccHHHHHcccccHHHHHHHHHHcccccccccccccccccEEEEEcccccccHHHHHHHHHcccccccEEEEEEcccccEEEEEcccccEEEEEEcccccHHHHHHHHHHHcccccccccc
****NIYEAVLFIVIISAVAVTSKEQLSTRECEDLGFTGLALCSDCNTFAEYVKDQELVADCLKCCTEDSDDSMSKITYSGAILEACMRKLVFYPEIVGFIEEEKDKFPTVRVQYVFNSPPKLIMLDEEGQHKETIRIDNWKREHMLQFLQE***********
xxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLSNIYEAVLFIVIISAVAVTSKEQLSTRECEDLGFTGLALCSDCNTFAEYVKDQELVADCLKCCTEDSDDSMSKITYSGAILEACMRKLVFYPEIVGFIEEEKDKFPTVRVQYVFNSPPKLIMLDEEGQHKETIRIDNWKREHMLQFLQEKVKPTSASAKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
15 kDa selenoprotein May be involved in redox reactions associated with the formation of disulfide bonds. May contribute to the quality control of protein folding in the endoplasmic reticulum.probableQ9ERR7
15 kDa selenoprotein May be involved in redox reactions associated with the formation of disulfide bonds. May contribute to the quality control of protein folding in the endoplasmic reticulum.probableA1Z623
15 kDa selenoprotein May be involved in redox reactions associated with the formation of disulfide bonds. May contribute to the quality control of protein folding in the endoplasmic reticulum.probableO60613

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A4H, chain A
Confidence level:very confident
Coverage over the Query: 71-159
View the alignment between query and template
View the model in PyMOL