Citrus Sinensis ID: 031270

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--

MPLLRTALYGKGIEIYCAPTADSRDVWQASMTHIALEGGCFVLSANQFCRRKDYPPPPEYVFSGIEEDLTPDSVVCAGGSVIISPSGTVLAGPNYEGEALISADLDLGEIAREKFAFDVVGHYSRPEVLSLVVRDHPATPVTYTSASVKTEGGLCITPVTIS

ccHHHHHHHHcccEEEEECcccccHHHHHHHHHHHHHccEEEEECccccccccccccccccccccccccccccccccccEEEEcccccEEcccccccccEEEEEccHHHHHHHHHccccccccccccEEEEEEcccccccEEEccccccccccccccccccc

MPLLRTALYGKGIEIYCAPTADSRDVWQASMTHIALEGGCFVLSANQFCRRKDYPPPPEYVFSGIEEDLTPDSVVCAGGSVIISPSGTVLAGPNYEGEALISADLDLGEIAREKFAFDVVGHYSRPEVLSLVVRDHPATPVTYTSA*********I******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MPLLRTALYGKGIEIYCAPTADSRDVWQASMTHIALEGGCFVLSANQFCRRKDYPPPPEYVFSGIEEDLTPDSVVCAGGSVIISPSGTVLAGPNYEGEALISADLDLGEIAREKFAFDVVGHYSRPEVLSLVVRDHPATPVTYTSASVKTEGGLCITPVTIS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Bifunctional nitrilase/nitrile hydratase NIT4	Highly specific for beta-cyano-L-alanine (Ala(CN)). Low activity with 3-phenylpropionitrile (PPN) or allylcyanide and no acitvity with indole-3-acetonitrile. Not associated with auxin production but may be involved in cyanide detoxification.	probable	P46011
Bifunctional nitrilase/nitrile hydratase NIT4	Highly specific for beta-cyano-L-alanine (Ala(CN)). Low activity with 3-phenylpropionitrile (PPN). Not associated with auxin production but may be involved in cyanide detoxification.	probable	Q6H849

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EMS, chain A
Confidence level:very confident
Coverage over the Query: 1-52,72-136
View the alignment between query and template
View the model in PyMOL