Citrus Sinensis ID: 031276


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MSLAPSVTRLHSPFLCCPLNKLSSSATTVSLSQRNQRSSAPYPCIRAELDQNTVVAISVGLVSVAVGIGIPIFYETQIDNAYDFPIFGAGQARKYSAMLPLQWLRCSFCMGTGSVTVELGGDEREFSKCINCDGVGSLTCTTCQGTGIQPRYLDRREFKDDD
ccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEEccEEEEEEEcccccccccccccccccccccccccccccccEECcccEEEEEEcccCEEECccccccccccEEEcccccccccccccccccccccc
**********HSPFLCCPLNKL*******************YPCIRAELDQNTVVAISVGLVSVAVGIGIPIFYETQIDNAYDFPIFGAGQARKYSAMLPLQWLRCSFCMGTGSVTVELGGDEREFSKCINCDGVGSLTCTTCQGTGIQPRYL*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLAPSVTRLHSPFLCCPLNKLSSSATTVSLSQRNQRSSAPYPCIRAELDQNTVVAISVGLVSVAVGIGIPIFYETQIDNAYDFPIFGAGQARKYSAMLPLQWLRCSFCMGTGSVTVELGGDEREFSKCINCDGVGSLTCTTCQGTGIQPRYLDRREFKDDD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein disulfide-isomerase LQY1 Protein disulfide-isomerase probably involved in maintaining photosystem II (PSII) activity under high light by regulating repair and reassembly of PSII complexes.probableQ8GSJ6

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NLT, chain A
Confidence level:confident
Coverage over the Query: 51-150
View the alignment between query and template
View the model in PyMOL