Citrus Sinensis ID: 031290

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MSRSLIQRLAPYFAARLRQNHRLLSSSPSSAAAALNEASSSPSSSESPSPSLDSIHMTDNFIKRMKELQASETSDNKAMLRLGVETGGCSGFQYAFDLDYKINPDDRIFEKDGVKLVVDNISYDFVKGATVDYVEELIRSAFVVRHFLLLSVFRFVIFSSSL
ccHHHHHHHccccccccccccccccccccHHHHHHcccccccccccccccccccEEEcHHHHHHHHHHHHHccccccccEEEEEEccccccCEEcEEEccccccccEEEECccEEEEEEcccHHHccccEEEccccccccccEEEccccccEEEEEEEEccc
*******RLAPYFAARLR*************************************HMTDNFIKRMKEL********KAMLRLGVETGGCSGFQYAFDLDYKINPDDRIFEKDGVKLVVDNISYDFVKGATVDYVEELIRSAFVVRHFLLLSVFRFVIFSSSL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRSLIQRLAPYFAARLRQNHRLLSSSPSSAAAALNEASSSPSSSESPSPSLDSIHMTDNFIKRMKELQASETSDNKAMLRLGVETGGCSGFQYAFDLDYKINPDDRIFEKDGVKLVVDNISYDFVKGATVDYVEELIRSAFVVRHFLLLSVFRFVIFSSSL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Iron-sulfur assembly protein IscA-like 2, mitochondrial Involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.probableQ8LCY2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2D2A, chain A
Confidence level:very confident
Coverage over the Query: 51-153
View the alignment between query and template
View the model in PyMOL