Citrus Sinensis ID: 031298

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--

MVVVEQSHMENSHLQSRFSASHSSLNMGIDPHAQAHAVSEFQLYSGGASGTSGSDKAKQSGKKGDHKGTKKHRYAFQTRSQVDILDDGYRWRKYGQKVVKNSKFPRSYYKCTHKGCNVKKQVQRNTKDEEIVVTTYEGLHTHPIGKITDSFEQILLKACTTS

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccEEEcccccccccccEEcccccccEEEEcECcccccccccccccHHHHHHHccccc

*************************************************************************YAFQTRSQVDILDDGYRWRKYGQKVVKNSKFPRSYYKCTHKGCNVKKQVQRNTKDEEIVVTTYEGLHT*********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVVVEQSHMENSHLQSRFSASHSSLNMGIDPHAQAHAVSEFQLYSGGASGTSGSDKAKQSGKKGDHKGTKKHRYAFQTRSQVDILDDGYRWRKYGQKVVKNSKFPRSYYKCTHKGCNVKKQVQRNTKDEEIVVTTYEGLHTHPIGKITDSFEQILLKACTTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable WRKY transcription factor 75	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element.	probable	Q9FYA2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WJ2, chain A
Confidence level:very confident
Coverage over the Query: 76-146
View the alignment between query and template
View the model in PyMOL