Citrus Sinensis ID: 031306

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-

MASLSITTSIPPPWLTSKSTHHSRRIPSASLILRTGRSSVSVNVAGNNSSPSRPGLLHCSFVSSSLCSSAFHSAFSGLSLGLDFNSNAGVRKEKRQGLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAILKRRRAKGRWVLCPKSYPNSGKRA

ccccccccccccccccccccccccccccccEEEECcccCEEEEEcccccccccccccEEccccccccccccccccccccccEEECcccccccccccEEEEEccccEEEEccccccHHHHHHHHcccccccccHHHHHHHHHHHcccEEECccccccccccc

*********IPP*WLTS********I*****************************LLHCSFVSS*****AFHSAFSGLSLGLDFNSNAGV*****QGLVVRAGKAALC****************************IL**RRAKGRWVLC***********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASLSITTSIPPPWLTSKSTHHSRRIPSASLILRTGRSSVSVNVAGNNSSPSRPGLLHCSFVSSSLCSSAFHSAFSGLSLGLDFNSNAGVRKEKRQGLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAILKRRRAKGRWVLCPKSYPNSGKRA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
50S ribosomal protein L34, chloroplastic	This protein binds directly to 23S ribosomal RNA.	probable	Q9LP37
50S ribosomal protein L34, chloroplastic	This protein binds directly to 23S ribosomal RNA.	probable	P82244
50S ribosomal protein L34		probable	B5EJJ2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain 4
Confidence level:very confident
Coverage over the Query: 115-151
View the alignment between query and template
View the model in PyMOL