Citrus Sinensis ID: 031333

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-

MRVICWVFRGFQDNTDKIQINSDTRSRKIEELKSCPFSEICWYFTESWDQFRINGRVDVIDGSNSDPEKLQIREKSWFGCSMKARLQYLDPEQGCPSVNEQPKEFSLDPCAGPVDAFCVLILDPDQVDYLNLKSNQKLKFMSRLSDNGEKYWASLKTSPEC

ccEEEEEEcccccccccEEEEEccccccHHHHHccccEEEEEEEccccEEEEEEEEEEEEccccccHHHHHHHHHHHHcccHHHHHccccccccccccccccccccccccccccccEEEEEECccCEEEEEccccccEEEEEEEcccccccEEEEEEEccc

MRVICWVFRGFQDNTDKIQINSDTRSRKIEELKSCPFSEICWYFTESWDQFRINGRVDVIDGSNSDPEKLQIREKSWFGCSMKARLQYLDP*****************PCAGPVDAFCVLILDPDQVDYLNLKSNQKLKFMSRLSDNGEKYWASLKTSPEC

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MRVICWVFRGFQDNTDKIQINSDTRSRKIEELKSCPFSEICWYFTESWDQFRINGRVDVIDGSNSDPEKLQIREKSWFGCSMKARLQYLDPEQGCPSVNEQPKEFSLDPCAGPVDAFCVLILDPDQVDYLNLKSNQKLKFMSRLSDNGEKYWASLKTSPEC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Pyridoxine/pyridoxamine 5'-phosphate oxidase 2	Catalyzes the oxidation of either pyridoxine 5'-phosphate (PNP) or pyridoxamine 5'-phosphate (PMP) into pyridoxal 5'-phosphate (PLP). Has an in vitro catalytic efficiency for PNP approximately 300-fold lower than that of PPOX1.	probable	Q9ZPY1

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I51, chain A
Confidence level:very confident
Coverage over the Query: 1-159
View the alignment between query and template
View the model in PyMOL