Citrus Sinensis ID: 031367


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MPALFSLLSNSGSIVVVIKSAYSLLFNPKDLPLNDVVFVGSLQALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDDVYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNEDFLKEIQSE
cccEEEEEEcccEEEEEEEccccCECcccccccEEEEEEccccccccEEEEEEEcccccEEEEEEEccccccccEEEEEEEccccccccccccEEEEEEEccHHHHHHHHHHHHHHcccCEEcccccccccccEEEEEEcccccEEEEEEcccHHHHHHcc
**ALFSLLSNSGSIVVVIKSAYSLLFNPKDLPLNDVVFVGSLQALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDDVYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNED********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPALFSLLSNSGSIVVVIKSAYSLLFNPKDLPLNDVVFVGSLQALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDDVYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNEDFLKEIQSE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Lactoylglutathione lyase Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione.probableQ948T6

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F9Z, chain A
Confidence level:very confident
Coverage over the Query: 31-151
View the alignment between query and template
View the model in PyMOL
Template: 3ZI1, chain A
Confidence level:very confident
Coverage over the Query: 11-155
View the alignment between query and template
View the model in PyMOL