Citrus Sinensis ID: 031367


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MPALFSLLSNSGSIVVVIKSAYSLLFNPKDLPLNDVVFVGSLQALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDDVYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNEDFLKEIQSE
cccEEEEEEcccEEEEEEEccccEEEcccccccEEEEEEccccccccEEEEEEEcccccEEEEEEEccccccccEEEEEEEccccccccccccEEEEEEEccHHHHHHHHHHHHHHcccEEEcccccccccccEEEEEEcccccEEEEEEcccHHHHHHcc
cccEEEEEccccEEEEEEEccccccccccccccEEEEEcccHHHHHHHHHEccccccccEEEEEEEcccccccEEEEEEEEcccccccccccEEEEEEEcHHHHHHHHHHHHHHHHccccEEEcccccccccEEEEEEEcccccEEEEEEcccccHHHccc
MPALFSLLSNSGSIVVVIKSAYsllfnpkdlplndvvFVGSLQALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNygvteytkgnAYAQVAISTDDVYKSAEVVNLVTQELggkitrqpgsipglntkitsfvdpdgwktvLVDNEDFLKEIQSE
MPALFSLLSNSGSIVVVIKSAYSLLFNPKDLPLNDVVFVGSLQALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDDVYKSAEVVNLVTQelggkitrqpgsipglnTKITsfvdpdgwktVLVDNEDFLKEIQSE
MPALFSLLSNSGSIVVVIKSAYSLLFNPKDLPLNDVVFVGSLQALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDDVYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNEDFLKEIQSE
****FSLLSNSGSIVVVIKSAYSLLFNPKDLPLNDVVFVGSLQALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDDVYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNEDFL******
**ALF**LSNSGSIVVVIKSAYSLLFNPKDLPLNDVVFVGSLQALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDDVYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVD***********
MPALFSLLSNSGSIVVVIKSAYSLLFNPKDLPLNDVVFVGSLQALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDDVYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNEDFLKEIQSE
MPALFSLLSNSGSIVVVIKSAYSLLFNPKDLPLNDVVFVGSLQALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDDVYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNED********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPALFSLLSNSGSIVVVIKSAYSLLFNPKDLPLNDVVFVGSLQALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDDVYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNEDFLKEIQSE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query161 2.2.26 [Sep-21-2011]
Q948T6291 Lactoylglutathione lyase yes no 0.708 0.391 0.811 2e-51
Q39366282 Putative lactoylglutathio N/A no 0.937 0.535 0.590 1e-47
Q8W593350 Probable lactoylglutathio no no 0.701 0.322 0.683 3e-43
Q9KT93138 Probable lactoylglutathio no no 0.658 0.768 0.472 2e-24
P0A1Q2135 Lactoylglutathione lyase yes no 0.726 0.866 0.426 8e-23
P0A1Q3135 Lactoylglutathione lyase N/A no 0.726 0.866 0.426 8e-23
P44638135 Lactoylglutathione lyase yes no 0.645 0.770 0.462 8e-23
P0AC83135 Lactoylglutathione lyase yes no 0.726 0.866 0.418 8e-22
P0AC81135 Lactoylglutathione lyase N/A no 0.726 0.866 0.418 8e-22
P0AC82135 Lactoylglutathione lyase N/A no 0.726 0.866 0.418 8e-22
>sp|Q948T6|LGUL_ORYSJ Lactoylglutathione lyase OS=Oryza sativa subsp. japonica GN=GLX-I PE=1 SV=2 Back     alignment and function desciption
 Score =  201 bits (511), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 106/117 (90%)

Query: 43  QALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDD 102
           +ALGMKLLR  D P+YKYT+AMLGYA+ED+TTV+ELTYNYGVTEYTKGNAYAQVAI T+D
Sbjct: 175 KALGMKLLRKKDVPDYKYTIAMLGYADEDKTTVIELTYNYGVTEYTKGNAYAQVAIGTED 234

Query: 103 VYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNEDFLKEIQ 159
           VYKSAE V LVT+ELGGKI RQPG +PGLNTKI SF+DPDGWK VLVDN DFLKE+Q
Sbjct: 235 VYKSAEAVELVTKELGGKILRQPGPLPGLNTKIASFLDPDGWKVVLVDNADFLKELQ 291




Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 4EC: .EC: 4EC: .EC: 1EC: .EC: 5
>sp|Q39366|LGUL_BRAOG Putative lactoylglutathione lyase OS=Brassica oleracea var. gemmifera PE=2 SV=1 Back     alignment and function description
>sp|Q8W593|LGUC_ARATH Probable lactoylglutathione lyase, chloroplast OS=Arabidopsis thaliana GN=At1g67280 PE=2 SV=1 Back     alignment and function description
>sp|Q9KT93|LGUL_VIBCH Probable lactoylglutathione lyase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gloA PE=3 SV=2 Back     alignment and function description
>sp|P0A1Q2|LGUL_SALTY Lactoylglutathione lyase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gloA PE=3 SV=1 Back     alignment and function description
>sp|P0A1Q3|LGUL_SALTI Lactoylglutathione lyase OS=Salmonella typhi GN=gloA PE=3 SV=1 Back     alignment and function description
>sp|P44638|LGUL_HAEIN Lactoylglutathione lyase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gloA PE=1 SV=1 Back     alignment and function description
>sp|P0AC83|LGUL_SHIFL Lactoylglutathione lyase OS=Shigella flexneri GN=gloA PE=3 SV=1 Back     alignment and function description
>sp|P0AC81|LGUL_ECOLI Lactoylglutathione lyase OS=Escherichia coli (strain K12) GN=gloA PE=1 SV=1 Back     alignment and function description
>sp|P0AC82|LGUL_ECO57 Lactoylglutathione lyase OS=Escherichia coli O157:H7 GN=gloA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
2213425 291 hypothetical protein [Citrus x paradisi] 0.714 0.395 0.991 2e-61
224078584 294 predicted protein [Populus trichocarpa] 0.714 0.391 0.873 2e-55
359483362 292 PREDICTED: lactoylglutathione lyase [Vit 0.925 0.510 0.680 2e-54
388493080 274 unknown [Medicago truncatula] 0.701 0.412 0.846 3e-53
356555674 287 PREDICTED: putative lactoylglutathione l 0.913 0.512 0.670 1e-52
356531939 296 PREDICTED: putative lactoylglutathione l 0.701 0.381 0.820 3e-52
211906514 289 lactoylglutathione lyase [Gossypium hirs 0.701 0.391 0.820 8e-52
449433964 292 PREDICTED: putative lactoylglutathione l 0.714 0.393 0.798 3e-50
388520197 284 unknown [Lotus japonicus] 0.701 0.397 0.803 4e-50
356520071 303 PREDICTED: putative lactoylglutathione l 0.701 0.372 0.811 4e-50
>gi|2213425|emb|CAB09799.1| hypothetical protein [Citrus x paradisi] Back     alignment and taxonomy information
 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 119/119 (100%)

Query: 43  QALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDD 102
           +ALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDD
Sbjct: 173 KALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDD 232

Query: 103 VYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNEDFLKEIQSE 161
           VYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNEDFLKEIQSE
Sbjct: 233 VYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNEDFLKEIQSE 291




Source: Citrus x paradisi

Species: Citrus x paradisi

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224078584|ref|XP_002305564.1| predicted protein [Populus trichocarpa] gi|222848528|gb|EEE86075.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359483362|ref|XP_002273346.2| PREDICTED: lactoylglutathione lyase [Vitis vinifera] gi|302144130|emb|CBI23235.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388493080|gb|AFK34606.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356555674|ref|XP_003546155.1| PREDICTED: putative lactoylglutathione lyase-like [Glycine max] Back     alignment and taxonomy information
>gi|356531939|ref|XP_003534533.1| PREDICTED: putative lactoylglutathione lyase-like [Glycine max] Back     alignment and taxonomy information
>gi|211906514|gb|ACJ11750.1| lactoylglutathione lyase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|449433964|ref|XP_004134766.1| PREDICTED: putative lactoylglutathione lyase-like [Cucumis sativus] gi|449479479|ref|XP_004155610.1| PREDICTED: putative lactoylglutathione lyase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388520197|gb|AFK48160.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356520071|ref|XP_003528689.1| PREDICTED: putative lactoylglutathione lyase-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
TAIR|locus:2019574350 AT1G67280 [Arabidopsis thalian 0.701 0.322 0.683 2e-40
UNIPROTKB|Q9KT93138 gloA "Probable lactoylglutathi 0.658 0.768 0.472 5.3e-24
TIGR_CMR|VC_1010138 VC_1010 "lactoylglutathione ly 0.658 0.768 0.472 5.3e-24
UNIPROTKB|P0AC81135 gloA "GloA" [Escherichia coli 0.658 0.785 0.464 3.4e-22
TIGR_CMR|SO_2044136 SO_2044 "lactoylglutathione ly 0.614 0.727 0.480 1.5e-21
DICTYBASE|DDB_G0291265136 gloA "glyoxylase I" [Dictyoste 0.658 0.779 0.437 4.9e-21
WB|WBGene00006448 281 glod-4 [Caenorhabditis elegans 0.329 0.188 0.377 3e-07
UNIPROTKB|Q09253 281 glod-4 "Glyoxalase 1" [Caenorh 0.329 0.188 0.377 3e-07
FB|FBgn0031143 293 CG1532 [Drosophila melanogaste 0.484 0.266 0.376 3.3e-07
UNIPROTKB|E3N6P2 281 Cre-glod-4 "CRE-GLOD-4 protein 0.329 0.188 0.358 4.1e-07
TAIR|locus:2019574 AT1G67280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 430 (156.4 bits), Expect = 2.0e-40, P = 2.0e-40
 Identities = 80/117 (68%), Positives = 97/117 (82%)

Query:    43 QALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDD 102
             +A GM+LLRT D PEYKYT+AM+GY  ED+  VLELTYNYGVTEY KGNAYAQ+AI TDD
Sbjct:   238 KAFGMELLRTRDNPEYKYTIAMMGYGPEDKFPVLELTYNYGVTEYDKGNAYAQIAIGTDD 297

Query:   103 VYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNEDFLKEIQ 159
             VYK+AE + L     GGKITR+PG +PG++TKIT+ +DPDGWK+V VDN DFLKE++
Sbjct:   298 VYKTAEAIKL----FGGKITREPGPLPGISTKITACLDPDGWKSVFVDNIDFLKELE 350


GO:0004462 "lactoylglutathione lyase activity" evidence=IEA;ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0005975 "carbohydrate metabolic process" evidence=ISS
GO:0046872 "metal ion binding" evidence=IEA
GO:0031977 "thylakoid lumen" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0009409 "response to cold" evidence=IEP
GO:0010319 "stromule" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
UNIPROTKB|Q9KT93 gloA "Probable lactoylglutathione lyase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1010 VC_1010 "lactoylglutathione lyase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|P0AC81 gloA "GloA" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SO_2044 SO_2044 "lactoylglutathione lyase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291265 gloA "glyoxylase I" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
WB|WBGene00006448 glod-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q09253 glod-4 "Glyoxalase 1" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0031143 CG1532 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E3N6P2 Cre-glod-4 "CRE-GLOD-4 protein" [Caenorhabditis remanei (taxid:31234)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q948T6LGUL_ORYSJ4, ., 4, ., 1, ., 50.81190.70800.3917yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_Genewise1_v1.C_LG_IV1582
lactoylglutathione lyase (EC-4.4.1.5) (294 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_fgenesh4_pg.C_1250018
hydroxyacylglutathione hydrolase (EC-3.1.2.6) (259 aa)
      0.911
gw1.XI.471.1
tryptophan synthase, beta chain (EC-4.2.1.20) (398 aa)
       0.800
gw1.XI.1757.1
tryptophan synthase, beta chain (EC-4.2.1.20) (378 aa)
       0.800
gw1.123.110.1
hypothetical protein (461 aa)
       0.800
fgenesh4_pg.C_LG_XIII000422
tryptophan synthase, beta chain (EC-4.2.1.20) (410 aa)
       0.800
eugene3.00120775
hypothetical protein (752 aa)
       0.800
estExt_fgenesh4_pg.C_LG_XV0575
hypothetical protein (700 aa)
       0.800
estExt_fgenesh4_pg.C_LG_V1322
tryptophan synthase (EC-4.2.1.20) (310 aa)
       0.800
estExt_fgenesh4_pg.C_LG_II0422
SubName- Full=Putative uncharacterized protein; (310 aa)
       0.800
estExt_fgenesh4_pg.C_280257
threonine deaminase (EC-4.3.1.19) (543 aa)
       0.800

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
PLN02300286 PLN02300, PLN02300, lactoylglutathione lyase 4e-70
TIGR00068150 TIGR00068, glyox_I, lactoylglutathione lyase 2e-35
PLN02300 286 PLN02300, PLN02300, lactoylglutathione lyase 2e-29
PRK10291129 PRK10291, PRK10291, glyoxalase I; Provisional 6e-29
cd07233121 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the 1e-26
cd08358127 cd08358, Glo_EDI_BRP_like_21, This conserved domai 2e-13
PLN03042185 PLN03042, PLN03042, Lactoylglutathione lyase; Prov 4e-11
pfam00903120 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resist 4e-09
PLN02367233 PLN02367, PLN02367, lactoylglutathione lyase 1e-08
>gnl|CDD|215169 PLN02300, PLN02300, lactoylglutathione lyase Back     alignment and domain information
 Score =  213 bits (543), Expect = 4e-70
 Identities = 86/117 (73%), Positives = 100/117 (85%), Gaps = 4/117 (3%)

Query: 43  QALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDD 102
           +A GMKLLR  D PEYKYT+AM+GY  ED+TTVLELTYNYGVTEYTKGNAYAQ+AI TDD
Sbjct: 174 KAFGMKLLRKRDNPEYKYTIAMMGYGPEDKTTVLELTYNYGVTEYTKGNAYAQIAIGTDD 233

Query: 103 VYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNEDFLKEIQ 159
           VYK+AE + LV    GGKITR+PG +PG+NTKIT+ +DPDGWKTV VDN DFLKE++
Sbjct: 234 VYKTAEAIKLV----GGKITREPGPLPGINTKITACLDPDGWKTVFVDNIDFLKELE 286


Length = 286

>gnl|CDD|232807 TIGR00068, glyox_I, lactoylglutathione lyase Back     alignment and domain information
>gnl|CDD|215169 PLN02300, PLN02300, lactoylglutathione lyase Back     alignment and domain information
>gnl|CDD|182358 PRK10291, PRK10291, glyoxalase I; Provisional Back     alignment and domain information
>gnl|CDD|176659 cd07233, Glyoxalase_I, Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>gnl|CDD|176706 cd08358, Glo_EDI_BRP_like_21, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>gnl|CDD|215548 PLN03042, PLN03042, Lactoylglutathione lyase; Provisional Back     alignment and domain information
>gnl|CDD|216182 pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily Back     alignment and domain information
>gnl|CDD|177995 PLN02367, PLN02367, lactoylglutathione lyase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 161
PLN02367233 lactoylglutathione lyase 99.89
PLN03042185 Lactoylglutathione lyase; Provisional 99.84
PRK10291129 glyoxalase I; Provisional 99.81
TIGR00068150 glyox_I lactoylglutathione lyase. Glyoxylase I is 99.81
PLN02300286 lactoylglutathione lyase 99.79
cd08358127 Glo_EDI_BRP_like_21 This conserved domain belongs 99.79
PLN02300 286 lactoylglutathione lyase 99.78
cd08353142 Glo_EDI_BRP_like_7 This conserved domain belongs t 99.78
cd07233121 Glyoxalase_I Glyoxalase I catalyzes the isomerizat 99.76
cd08342136 HPPD_N_like N-terminal domain of 4-hydroxyphenylpy 99.74
KOG2944170 consensus Glyoxalase [Carbohydrate transport and m 99.72
cd07241125 Glo_EDI_BRP_like_3 This conserved domain belongs t 99.71
PRK11478129 putative lyase; Provisional 99.71
TIGR03645162 glyox_marine lactoylglutathione lyase family prote 99.7
cd07243143 2_3_CTD_C C-terminal domain of catechol 2,3-dioxyg 99.66
TIGR03081128 metmalonyl_epim methylmalonyl-CoA epimerase. Membe 99.66
cd08352125 Glo_EDI_BRP_like_1 This conserved domain belongs t 99.66
PRK04101139 fosfomycin resistance protein FosB; Provisional 99.65
cd07257153 THT_oxygenase_C The C-terminal domain of 2,4,5-Tri 99.65
cd07265122 2_3_CTD_N N-terminal domain of catechol 2,3-dioxyg 99.64
cd08360134 MhqB_like_C C-terminal domain of Burkholderia sp. 99.64
cd07237154 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro 99.62
cd07247114 SgaA_N_like N-terminal domain of Streptomyces gris 99.61
cd07256161 HPCD_C_class_II C-terminal domain of 3,4-dihydroxy 99.6
cd08364131 FosX FosX, a fosfomycin resistance protein, cataly 99.59
PF00903128 Glyoxalase: Glyoxalase/Bleomycin resistance protei 99.58
cd09011120 Glo_EDI_BRP_like_23 This conserved domain belongs 99.58
TIGR02295294 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T 99.57
cd07253125 Glo_EDI_BRP_like_2 This conserved domain belongs t 99.57
cd08363131 FosB FosB, a fosfomycin resistance protein, cataly 99.57
cd08351123 ChaP_like ChaP, an enzyme involved in the biosynth 99.57
cd09014166 BphC-JF8_C_like C-terminal, catalytic, domain of B 99.57
PRK06724128 hypothetical protein; Provisional 99.57
cd07263119 Glo_EDI_BRP_like_16 This conserved domain belongs 99.57
cd08343131 ED_TypeI_classII_C C-terminal domain of type I, cl 99.56
cd08355122 Glo_EDI_BRP_like_14 This conserved domain belongs 99.56
TIGR03211303 catechol_2_3 catechol 2,3 dioxygenase. Members of 99.55
cd08346126 PcpA_N_like N-terminal domain of Sphingobium chlor 99.55
cd07249128 MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als 99.55
cd08347157 PcpA_C_like C-terminal domain of Sphingobium chlor 99.54
cd09013121 BphC-JF8_N_like N-terminal, non-catalytic, domain 99.54
cd07258141 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cuma 99.54
cd07266121 HPCD_N_class_II N-terminal domain of 3,4-dihydroxy 99.53
cd07242128 Glo_EDI_BRP_like_6 This conserved domain belongs t 99.53
KOG2943 299 consensus Predicted glyoxalase [Carbohydrate trans 99.53
KOG2943299 consensus Predicted glyoxalase [Carbohydrate trans 99.53
cd07239144 BphC5-RK37_C_like C-terminal, catalytic, domain of 99.52
cd07245114 Glo_EDI_BRP_like_9 This conserved domain belongs t 99.52
cd07246122 Glo_EDI_BRP_like_8 This conserved domain belongs t 99.52
cd08361124 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cuma 99.52
cd07255125 Glo_EDI_BRP_like_12 This conserved domain belongs 99.5
cd07252120 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro 99.5
cd08348134 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro 99.5
cd07264125 Glo_EDI_BRP_like_15 This conserved domain belongs 99.49
cd07240117 ED_TypeI_classII_N N-terminal domain of type I, cl 99.49
cd08359119 Glo_EDI_BRP_like_22 This conserved domain belongs 99.47
cd07262123 Glo_EDI_BRP_like_19 This conserved domain belongs 99.46
cd07267113 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydr 99.44
cd07235122 MRD Mitomycin C resistance protein (MRD). Mitomyci 99.44
TIGR03213286 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase 99.44
cd07244121 FosA FosA, a Fosfomycin resistance protein, cataly 99.44
cd08345113 Fosfomycin_RP Fosfomycin resistant protein; inhibi 99.43
cd09012124 Glo_EDI_BRP_like_24 This conserved domain belongs 99.42
cd08350120 BLMT_like BLMT, a bleomycin resistance protein enc 99.41
cd08362120 BphC5-RrK37_N_like N-terminal, non-catalytic, doma 99.41
cd08354122 Glo_EDI_BRP_like_13 This conserved domain belongs 99.4
cd07238112 Glo_EDI_BRP_like_5 This conserved domain belongs t 99.4
cd06587112 Glo_EDI_BRP_like This domain superfamily is found 99.39
cd08349112 BLMA_like Bleomycin binding protein (BLMA) and sim 99.38
PF12681108 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 99.38
cd08357125 Glo_EDI_BRP_like_18 This conserved domain belongs 99.35
TIGR03211 303 catechol_2_3 catechol 2,3 dioxygenase. Members of 99.34
cd07254120 Glo_EDI_BRP_like_20 This conserved domain belongs 99.34
cd08344112 MhqB_like_N N-terminal domain of MhqB, a type I ex 99.33
TIGR02295 294 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T 99.32
PF13669109 Glyoxalase_4: Glyoxalase/Bleomycin resistance prot 99.3
cd07261114 Glo_EDI_BRP_like_11 This conserved domain belongs 99.3
TIGR03213 286 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase 99.26
cd08356113 Glo_EDI_BRP_like_17 This conserved domain belongs 99.24
cd07251121 Glo_EDI_BRP_like_10 This conserved domain belongs 99.2
cd07250191 HPPD_C_like C-terminal domain of 4-hydroxyphenylpy 98.96
COG2514 265 Predicted ring-cleavage extradiol dioxygenase [Gen 98.76
COG3324127 Predicted enzyme related to lactoylglutathione lya 98.74
TIGR01263353 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr 98.62
TIGR01263 353 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr 98.59
cd06588128 PhnB_like Escherichia coli PhnB and similar protei 98.58
COG0346138 GloA Lactoylglutathione lyase and related lyases [ 98.56
PLN02875398 4-hydroxyphenylpyruvate dioxygenase 98.34
COG3565138 Predicted dioxygenase of extradiol dioxygenase fam 98.15
COG2764136 PhnB Uncharacterized protein conserved in bacteria 98.12
COG3607133 Predicted lactoylglutathione lyase [General functi 97.9
PF13468175 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B. 97.79
PRK10148147 hypothetical protein; Provisional 97.35
PLN02875 398 4-hydroxyphenylpyruvate dioxygenase 97.27
PF14696139 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, H 97.24
KOG0638 381 consensus 4-hydroxyphenylpyruvate dioxygenase [Ami 97.23
PF13669109 Glyoxalase_4: Glyoxalase/Bleomycin resistance prot 97.09
COG3185363 4-hydroxyphenylpyruvate dioxygenase and related he 96.99
PRK01037357 trmD tRNA (guanine-N(1)-)-methyltransferase/unknow 96.89
KOG0638381 consensus 4-hydroxyphenylpyruvate dioxygenase [Ami 95.99
PF14506125 CppA_N: CppA N-terminal; PDB: 3E0R_D. 95.68
TIGR03645162 glyox_marine lactoylglutathione lyase family prote 95.31
cd08346126 PcpA_N_like N-terminal domain of Sphingobium chlor 94.92
cd08353142 Glo_EDI_BRP_like_7 This conserved domain belongs t 94.89
cd08352125 Glo_EDI_BRP_like_1 This conserved domain belongs t 94.4
COG2514265 Predicted ring-cleavage extradiol dioxygenase [Gen 93.89
cd07249128 MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als 93.4
PF13468 175 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B. 92.62
cd07241125 Glo_EDI_BRP_like_3 This conserved domain belongs t 91.92
cd07245114 Glo_EDI_BRP_like_9 This conserved domain belongs t 91.58
cd07233121 Glyoxalase_I Glyoxalase I catalyzes the isomerizat 90.66
COG3185 363 4-hydroxyphenylpyruvate dioxygenase and related he 90.52
PRK11478129 putative lyase; Provisional 90.46
cd07242128 Glo_EDI_BRP_like_6 This conserved domain belongs t 90.46
PF00903128 Glyoxalase: Glyoxalase/Bleomycin resistance protei 90.26
PLN03042185 Lactoylglutathione lyase; Provisional 89.95
cd06587112 Glo_EDI_BRP_like This domain superfamily is found 89.55
cd08347157 PcpA_C_like C-terminal domain of Sphingobium chlor 88.69
cd07263119 Glo_EDI_BRP_like_16 This conserved domain belongs 87.92
cd07250 191 HPPD_C_like C-terminal domain of 4-hydroxyphenylpy 87.17
TIGR03081128 metmalonyl_epim methylmalonyl-CoA epimerase. Membe 86.1
cd07255125 Glo_EDI_BRP_like_12 This conserved domain belongs 85.98
PLN02367233 lactoylglutathione lyase 85.12
cd08360134 MhqB_like_C C-terminal domain of Burkholderia sp. 84.54
cd08348134 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro 84.37
PF02676205 TYW3: Methyltransferase TYW3; InterPro: IPR003827 84.2
cd08364131 FosX FosX, a fosfomycin resistance protein, cataly 83.44
cd08358127 Glo_EDI_BRP_like_21 This conserved domain belongs 83.1
cd08342136 HPPD_N_like N-terminal domain of 4-hydroxyphenylpy 82.46
cd07257153 THT_oxygenase_C The C-terminal domain of 2,4,5-Tri 81.67
cd07237154 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro 80.64
>PLN02367 lactoylglutathione lyase Back     alignment and domain information
Probab=99.89  E-value=5.3e-22  Score=155.19  Aligned_cols=124  Identities=31%  Similarity=0.561  Sum_probs=101.8

Q ss_pred             CCCCcceeEEE-eeCCc--------cccCCEEEEEEeCCCCcEEEEEeeccCC---------------CCceEEEEeeeC
Q 031367           27 NPKDLPLNDVV-FVGSL--------QALGMKLLRTVDKPEYKYTLAMLGYAEE---------------DQTTVLELTYNY   82 (161)
Q Consensus        27 ~~~~~~i~Hv~-~V~Dl--------~vLG~~~~~~~~~~~g~~~~~~l~~~~~---------------~~~~~leL~~~~   82 (161)
                      ......++|++ +|+|+        ++|||++.++.++++++++++|+++++.               .+...|||++++
T Consensus        70 ~t~~~~~~HtmlRVkDle~Sl~FYt~vLGm~ll~r~d~pe~~f~lyFL~~~~~~~~p~d~~~r~~~~~~~~~~LELt~n~  149 (233)
T PLN02367         70 ATKGYIMQQTMYRIKDPKASLDFYSRVLGMSLLKRLDFPEMKFSLYFMGYEDTASAPTDPTERTVWTFGQKATIELTHNW  149 (233)
T ss_pred             CCCCcEEEEEEEEeCCHHHHHHHHHHhcCCEEeEEEecCCCcEEEEEeecCCccccccccccceeeccCCCCEEEEecCC
Confidence            35679999999 99999        8999999999999888899999976431               124689999887


Q ss_pred             CCcc------cccC----CCeeEEEEEeCCHHHHHHHHhHHHHhcCCeeecCCcccCCCceEEEEEECCCCCEEEEEecC
Q 031367           83 GVTE------YTKG----NAYAQVAISTDDVYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNE  152 (161)
Q Consensus        83 ~~~~------~~~g----~g~~Hiaf~V~Di~~~~~~L~~~~~~~Gv~i~~~p~~~~~~~~~~~f~~DPDG~~IEl~~~~  152 (161)
                      +...      |..+    .|++||||.|+|+++++++|    +++|+++..+|...++  .+.+||+|||||+|||++..
T Consensus       150 g~e~~~~~~~y~~gn~~p~G~~HIaf~VdDVdaa~erL----~a~Gv~~v~~P~~g~~--~riaFIkDPDGn~IEL~e~~  223 (233)
T PLN02367        150 GTESDPDFKGYHNGNSEPRGFGHIGITVDDVYKACERF----EELGVEFVKKPNDGKM--KGIAFIKDPDGYWIEIFDLK  223 (233)
T ss_pred             CCCccccchhcccCCCCCCCceEEEEEcCCHHHHHHHH----HHCCCEEEeCCccCCc--eEEEEEECCCCCEEEEEecc
Confidence            7541      4333    37999999999999999999    5999999988875432  57899999999999999987


Q ss_pred             Cchh
Q 031367          153 DFLK  156 (161)
Q Consensus       153 ~~~~  156 (161)
                      ...+
T Consensus       224 ~~~~  227 (233)
T PLN02367        224 TIGT  227 (233)
T ss_pred             cccc
Confidence            6553



>PLN03042 Lactoylglutathione lyase; Provisional Back     alignment and domain information
>PRK10291 glyoxalase I; Provisional Back     alignment and domain information
>TIGR00068 glyox_I lactoylglutathione lyase Back     alignment and domain information
>PLN02300 lactoylglutathione lyase Back     alignment and domain information
>cd08358 Glo_EDI_BRP_like_21 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PLN02300 lactoylglutathione lyase Back     alignment and domain information
>cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>KOG2944 consensus Glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PRK11478 putative lyase; Provisional Back     alignment and domain information
>TIGR03645 glyox_marine lactoylglutathione lyase family protein Back     alignment and domain information
>cd07243 2_3_CTD_C C-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase Back     alignment and domain information
>cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PRK04101 fosfomycin resistance protein FosB; Provisional Back     alignment and domain information
>cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway Back     alignment and domain information
>cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>cd08360 MhqB_like_C C-terminal domain of Burkholderia sp Back     alignment and domain information
>cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains Back     alignment and domain information
>cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1 Back     alignment and domain information
>PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein Back     alignment and domain information
>cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase Back     alignment and domain information
>cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08363 FosB FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin Back     alignment and domain information
>cd08351 ChaP_like ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha); and similar proteins Back     alignment and domain information
>cd09014 BphC-JF8_C_like C-terminal, catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>PRK06724 hypothetical protein; Provisional Back     alignment and domain information
>cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08343 ED_TypeI_classII_C C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain Back     alignment and domain information
>cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR03211 catechol_2_3 catechol 2,3 dioxygenase Back     alignment and domain information
>cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) Back     alignment and domain information
>cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>cd07258 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07239 BphC5-RK37_C_like C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins Back     alignment and domain information
>cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07246 Glo_EDI_BRP_like_8 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 Back     alignment and domain information
>cd07264 Glo_EDI_BRP_like_15 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain Back     alignment and domain information
>cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase Back     alignment and domain information
>cd07235 MRD Mitomycin C resistance protein (MRD) Back     alignment and domain information
>TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase Back     alignment and domain information
>cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive Back     alignment and domain information
>cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin Back     alignment and domain information
>cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08350 BLMT_like BLMT, a bleomycin resistance protein encoded on the transposon Tn5, and similar proteins Back     alignment and domain information
>cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins Back     alignment and domain information
>cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>cd08349 BLMA_like Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm Back     alignment and domain information
>PF12681 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A Back     alignment and domain information
>cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR03211 catechol_2_3 catechol 2,3 dioxygenase Back     alignment and domain information
>cd07254 Glo_EDI_BRP_like_20 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins Back     alignment and domain information
>TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase Back     alignment and domain information
>PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A Back     alignment and domain information
>cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase Back     alignment and domain information
>cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] Back     alignment and domain information
>COG3324 Predicted enzyme related to lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E Back     alignment and domain information
>COG0346 GloA Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02875 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>COG3565 Predicted dioxygenase of extradiol dioxygenase family [General function prediction only] Back     alignment and domain information
>COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3607 Predicted lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>PF13468 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B Back     alignment and domain information
>PRK10148 hypothetical protein; Provisional Back     alignment and domain information
>PLN02875 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>PF14696 Glyoxalase_5: Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal ; PDB: 1CJX_A 2R5V_A Back     alignment and domain information
>KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A Back     alignment and domain information
>COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK01037 trmD tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed Back     alignment and domain information
>KOG0638 consensus 4-hydroxyphenylpyruvate dioxygenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF14506 CppA_N: CppA N-terminal; PDB: 3E0R_D Back     alignment and domain information
>TIGR03645 glyox_marine lactoylglutathione lyase family protein Back     alignment and domain information
>cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] Back     alignment and domain information
>cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) Back     alignment and domain information
>PF13468 Glyoxalase_3: Glyoxalase-like domain; PDB: 3P8A_B Back     alignment and domain information
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>COG3185 4-hydroxyphenylpyruvate dioxygenase and related hemolysins [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK11478 putative lyase; Provisional Back     alignment and domain information
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein Back     alignment and domain information
>PLN03042 Lactoylglutathione lyase; Provisional Back     alignment and domain information
>cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase Back     alignment and domain information
>cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PLN02367 lactoylglutathione lyase Back     alignment and domain information
>cd08360 MhqB_like_C C-terminal domain of Burkholderia sp Back     alignment and domain information
>cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 Back     alignment and domain information
>PF02676 TYW3: Methyltransferase TYW3; InterPro: IPR003827 The methyltransferase TYW3 (tRNA-yW- synthesising protein 3) has been identified in yeast to be involved in wybutosine (yW) biosynthesis [] Back     alignment and domain information
>cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1 Back     alignment and domain information
>cd08358 Glo_EDI_BRP_like_21 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway Back     alignment and domain information
>cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
1f9z_A135 Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I 7e-23
2c21_A144 Specificity Of The Trypanothione-Dependednt Leishma 1e-14
2za0_A184 Crystal Structure Of Mouse Glyoxalase I Complexed W 3e-06
3vw9_A187 Human Glyoxalase I With An N-Hydroxypyridone Inhibi 4e-06
1bh5_A183 Human Glyoxalase I Q33e, E172q Double Mutant Length 4e-06
1fro_A183 Human Glyoxalase I With Benzyl-Glutathione Inhibito 4e-06
3zi1_A 330 Crystal Structure Of Human Glyoxalase Domain-contai 2e-05
>pdb|1F9Z|A Chain A, Crystal Structure Of The Ni(Ii)-Bound Glyoxalase I From Escherichia Coli Length = 135 Back     alignment and structure

Iteration: 1

Score = 102 bits (255), Expect = 7e-23, Method: Compositional matrix adjust. Identities = 54/129 (41%), Positives = 79/129 (61%), Gaps = 12/129 (9%) Query: 33 LNDVVFVGSLQ--------ALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGV 84 L+ ++ VG LQ LGMKLLRT + PEYKY+LA +GY E + V+ELTYN+GV Sbjct: 4 LHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGV 63 Query: 85 TEYTKGNAYAQVAISTDDVYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGW 144 +Y G AY +A+S D+ ++ E + ++ GG +TR+ G + G T I DPDG+ Sbjct: 64 DKYELGTAYGHIALSVDNAAEACEKI----RQNGGNVTREAGPVKGGTTVIAFVEDPDGY 119 Query: 145 KTVLVDNED 153 K L++ +D Sbjct: 120 KIELIEEKD 128
>pdb|2C21|A Chain A, Specificity Of The Trypanothione-Dependednt Leishmania Major Glyoxalase I: Structure And Biochemical Comparison With The Human Enzyme Length = 144 Back     alignment and structure
>pdb|2ZA0|A Chain A, Crystal Structure Of Mouse Glyoxalase I Complexed With Methyl-Gerfelin Length = 184 Back     alignment and structure
>pdb|3VW9|A Chain A, Human Glyoxalase I With An N-Hydroxypyridone Inhibitor Length = 187 Back     alignment and structure
>pdb|1BH5|A Chain A, Human Glyoxalase I Q33e, E172q Double Mutant Length = 183 Back     alignment and structure
>pdb|1FRO|A Chain A, Human Glyoxalase I With Benzyl-Glutathione Inhibitor Length = 183 Back     alignment and structure
>pdb|3ZI1|A Chain A, Crystal Structure Of Human Glyoxalase Domain-containing Protein 4 (glod4) Length = 330 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 5e-29
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 4e-28
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 1e-17
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 6e-13
1twu_A139 Hypothetical protein YYCE; structural genomics, pr 7e-13
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 4e-12
3r6a_A144 Uncharacterized protein; PSI biology, structural g 4e-10
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 4e-09
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 3e-08
2r6u_A148 Uncharacterized protein; structural genomics, PSI- 4e-08
2p25_A126 Glyoxalase family protein; structural genomics, MC 3e-07
3oxh_A282 RV0577 protein; kinase regulation, antibiotic resi 5e-06
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Length = 135 Back     alignment and structure
 Score =  102 bits (257), Expect = 5e-29
 Identities = 51/117 (43%), Positives = 76/117 (64%), Gaps = 6/117 (5%)

Query: 43  QALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDD 102
           + LGMKLLRT + PEYKY+LA +GY  E +  V+ELTYN+GV +Y  G AY  +A+S D+
Sbjct: 22  KVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVDKYELGTAYGHIALSVDN 81

Query: 103 VYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFV-DPDGWKTVLVDNEDFLKEI 158
             ++ E +    ++ GG +TR+ G + G  T I  FV DPDG+K  L++ +D  + +
Sbjct: 82  AAEACEKI----RQNGGNVTREAGPVKGGTTVIA-FVEDPDGYKIELIEEKDAGRGL 133


>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Length = 144 Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Length = 184 Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Length = 161 Back     alignment and structure
>1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Length = 139 Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} Length = 134 Back     alignment and structure
>3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Length = 144 Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Length = 133 Back     alignment and structure
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Length = 134 Back     alignment and structure
>2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Length = 148 Back     alignment and structure
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Length = 126 Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 99.85
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 99.81
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 99.8
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 99.79
3vw9_A187 Lactoylglutathione lyase; glyoxalase, lyase-lyase 99.78
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 99.78
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 99.77
3e5d_A127 Putative glyoxalase I; structural genomics, joint 99.77
4hc5_A133 Glyoxalase/bleomycin resistance protein/dioxygena; 99.77
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 99.76
2p25_A126 Glyoxalase family protein; structural genomics, MC 99.76
1ss4_A153 Glyoxalase family protein; structural genomics, PS 99.75
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 99.73
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 99.73
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 99.73
3gm5_A159 Lactoylglutathione lyase and related lyases; sheet 99.72
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 99.71
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 99.7
3zi1_A 330 Glyoxalase domain-containing protein 4; isomerase; 99.69
3ey7_A133 Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot 99.68
3ghj_A141 Putative integron gene cassette protein; integron 99.67
1twu_A139 Hypothetical protein YYCE; structural genomics, pr 99.66
2qqz_A126 Glyoxalase family protein, putative; alpha-beta st 99.66
3huh_A152 Virulence protein STM3117; structural genomics, ny 99.65
3sk2_A132 EHPR; antibiotic resistance, griseoluteate-binding 99.65
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 99.63
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 99.63
2i7r_A118 Conserved domain protein; structural genomics cons 99.63
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 99.63
3r6a_A144 Uncharacterized protein; PSI biology, structural g 99.61
3lm4_A339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 99.61
3g12_A128 Putative lactoylglutathione lyase; glyoxalase, ble 99.61
1xrk_A124 Bleomycin resistance protein; arm exchange, ligand 99.61
1npb_A141 Fosfomycin-resistance protein; manganese binding, 99.61
3fcd_A134 Lyase, ORF125EGC139; lactoylglutathione lyase, YEC 99.6
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 99.6
1nki_A135 Probable fosfomycin resistance protein; potassium 99.6
3rhe_A148 NAD-dependent benzaldehyde dehydrogenase; structur 99.6
3itw_A137 Protein TIOX; bleomycin resistance fold, bisinterc 99.6
2a4x_A138 Mitomycin-binding protein; ALFA/beta protein, mito 99.59
3rri_A135 Glyoxalase/bleomycin resistance protein/dioxygena; 99.59
2pjs_A119 AGR_C_3564P, uncharacterized protein ATU1953; glyo 99.59
3ct8_A146 Protein BH2160, putative glyoxalase; NP_243026.1, 99.58
3hpy_A309 Catechol 2,3-dioxygenase; repeated motifs, aromati 99.58
3oaj_A 335 Putative ring-cleaving dioxygenase MHQO; structura 99.57
3zi1_A330 Glyoxalase domain-containing protein 4; isomerase; 99.57
2kjz_A144 ATC0852; protein of unknown function, dimer, struc 99.57
2r6u_A148 Uncharacterized protein; structural genomics, PSI- 99.57
1f1u_A323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 99.56
1ecs_A126 Bleomycin resistance protein; arm-exchange, antibi 99.56
3zw5_A147 Glyoxalase domain-containing protein 5; lyase; 1.6 99.56
1mpy_A307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 99.56
1qto_A122 Bleomycin-binding protein; arm-exchange, antibioti 99.56
2zyq_A300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 99.55
1xqa_A113 Glyoxalase/bleomycin resistance protein; dioxygena 99.55
3m2o_A164 Glyoxalase/bleomycin resistance protein; unknown f 99.53
2rbb_A141 Glyoxalase/bleomycin resistance protein/dioxygena; 99.53
4gym_A149 Glyoxalase/bleomycin resistance protein/dioxygena; 99.51
2qnt_A141 AGR_C_3434P, uncharacterized protein ATU1872; glyo 99.49
1kw3_B292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 99.49
3b59_A310 Glyoxalase/bleomycin resistance protein/dioxygena; 99.48
2rk9_A145 Glyoxalase/bleomycin resistance protein/dioxygena; 99.48
1lgt_A297 Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy 99.47
1zsw_A 338 Metallo protein, glyoxalase family protein; hypoth 99.47
3bt3_A148 Glyoxalase-related enzyme, ARAC type; VOC superfam 99.44
3hpy_A 309 Catechol 2,3-dioxygenase; repeated motifs, aromati 99.42
3oaj_A335 Putative ring-cleaving dioxygenase MHQO; structura 99.41
2wl9_A305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 99.4
2r5v_A357 PCZA361.1; dioxygenase, non-heme iron, vancomycin, 99.4
1mpy_A 307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 99.39
2ehz_A302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 99.39
4ghg_A365 Homoprotocatechuate 2,3-dioxygenase; oxygen activa 99.36
3oxh_A282 RV0577 protein; kinase regulation, antibiotic resi 99.35
4ghg_A 365 Homoprotocatechuate 2,3-dioxygenase; oxygen activa 99.35
1zsw_A338 Metallo protein, glyoxalase family protein; hypoth 99.35
1t47_A 381 4-hydroxyphenylpyruvate dioxygenase; triketone inh 99.33
3lm4_A 339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 99.32
1f1u_A 323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 99.32
1kw3_B 292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 99.31
3oxh_A 282 RV0577 protein; kinase regulation, antibiotic resi 99.31
1lgt_A 297 Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy 99.31
2r5v_A 357 PCZA361.1; dioxygenase, non-heme iron, vancomycin, 99.31
2zyq_A 300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 99.3
2wl9_A 305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 99.29
1xy7_A166 Unknown protein; structural genomics, protein stru 99.29
2ehz_A 302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 99.28
3b59_A 310 Glyoxalase/bleomycin resistance protein/dioxygena; 99.26
3pkv_A 252 Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox 99.26
1u6l_A149 Hypothetical protein; structural genomics, PSI, pr 99.23
1sqd_A 424 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.22
2zw5_A301 Bleomycin acetyltransferase; dimer, two domains; H 99.17
1u7i_A136 Hypothetical protein; structural genomics, PA1358, 99.15
1sp8_A 418 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 99.08
3isq_A 393 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta 99.04
1t47_A381 4-hydroxyphenylpyruvate dioxygenase; triketone inh 99.03
1tsj_A139 Conserved hypothetical protein; structural genomic 98.95
1cjx_A357 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 98.93
1cjx_A 357 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 98.83
1sqd_A424 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 98.78
3l20_A172 Putative uncharacterized protein; hypothetical pro 98.72
3oms_A138 PHNB protein; structural genomics, PSI-2, protein 98.7
3isq_A393 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta 98.7
1sp8_A418 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 98.66
3e0r_A 244 C3-degrading proteinase (CPPA protein); MCSG, PSI, 98.13
3p8a_A274 Uncharacterized protein; mainly antiparallel beta 97.89
3opy_B 941 6-phosphofructo-1-kinase beta-subunit; ATP binding 96.68
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 96.24
1u69_A163 Hypothetical protein; structural genomics, MSCG, p 94.83
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 94.73
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 94.68
3e5d_A127 Putative glyoxalase I; structural genomics, joint 94.66
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 94.19
3gm5_A159 Lactoylglutathione lyase and related lyases; sheet 94.08
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 93.91
1ss4_A153 Glyoxalase family protein; structural genomics, PS 93.63
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 93.4
1xqa_A113 Glyoxalase/bleomycin resistance protein; dioxygena 93.32
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 92.42
2p25_A126 Glyoxalase family protein; structural genomics, MC 91.56
3vw9_A187 Lactoylglutathione lyase; glyoxalase, lyase-lyase 91.4
3pkv_A252 Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox 91.03
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 90.38
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 89.65
4hc5_A133 Glyoxalase/bleomycin resistance protein/dioxygena; 88.58
3ghj_A141 Putative integron gene cassette protein; integron 87.5
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 87.4
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 87.21
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 87.09
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 84.96
2a4x_A138 Mitomycin-binding protein; ALFA/beta protein, mito 83.93
3ct8_A146 Protein BH2160, putative glyoxalase; NP_243026.1, 83.45
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 83.24
3sk2_A132 EHPR; antibiotic resistance, griseoluteate-binding 83.0
3rhe_A148 NAD-dependent benzaldehyde dehydrogenase; structur 82.51
3iuz_A340 Putative glyoxalase superfamily protein; struct ge 81.69
2kjz_A144 ATC0852; protein of unknown function, dimer, struc 81.62
3g12_A128 Putative lactoylglutathione lyase; glyoxalase, ble 80.25
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 80.14
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Back     alignment and structure
Probab=99.85  E-value=4.5e-20  Score=129.33  Aligned_cols=120  Identities=44%  Similarity=0.800  Sum_probs=92.7

Q ss_pred             cceeEEE-eeCCc--------cccCCEEEEEEeCCCCcEEEEEeeccCCCCceEEEEeeeCCCcccccCCCeeEEEEEeC
Q 031367           31 LPLNDVV-FVGSL--------QALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTD  101 (161)
Q Consensus        31 ~~i~Hv~-~V~Dl--------~vLG~~~~~~~~~~~g~~~~~~l~~~~~~~~~~leL~~~~~~~~~~~g~g~~Hiaf~V~  101 (161)
                      |+++|+. .|+|+        ++|||++..+...+++.+.++++..++......++|...........+.+..|++|.|+
T Consensus         1 m~l~hv~l~v~D~~~a~~FY~~~lG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~l~~~~~~~~~~~~~~~~~~~~~v~   80 (135)
T 1f9z_A            1 MRLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVDKYELGTAYGHIALSVD   80 (135)
T ss_dssp             CCEEEEEEECSCHHHHHHHHHHTTCCEEEEEEEETTTTEEEEEEESSCTTTSCEEEEEEETTCCCCCCCSSEEEEEEECS
T ss_pred             CcceEEEEEeCCHHHHHHHHHhccCcEEEEecccCCCceEEEEEecCCCCCCcEEEEEEcCCCCcccCCCCccEEEEEeC
Confidence            5799999 99999        89999998876655566777788765422346788865443322334457889999999


Q ss_pred             CHHHHHHHHhHHHHhcCCeeecCCcccCCCceEEEEEECCCCCEEEEEecCCc
Q 031367          102 DVYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNEDF  154 (161)
Q Consensus       102 Di~~~~~~L~~~~~~~Gv~i~~~p~~~~~~~~~~~f~~DPDG~~IEl~~~~~~  154 (161)
                      |+++++++|    +++|+++..+|...+++..+.+||+|||||.|||++....
T Consensus        81 d~~~~~~~l----~~~G~~~~~~~~~~~~g~~~~~~~~DPdG~~iel~~~~~~  129 (135)
T 1f9z_A           81 NAAEACEKI----RQNGGNVTREAGPVKGGTTVIAFVEDPDGYKIELIEEKDA  129 (135)
T ss_dssp             CHHHHHHHH----HHTTCEEEEEEEECTTSCCEEEEEECTTSCEEEEEEC---
T ss_pred             CHHHHHHHH----HHCCCEEecCCccCCCCceeEEEEECCCCCEEEEEecCCC
Confidence            999999999    5999999988877766545789999999999999997653



>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Back     alignment and structure
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Back     alignment and structure
>3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* Back     alignment and structure
>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Back     alignment and structure
>4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Back     alignment and structure
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} Back     alignment and structure
>3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Back     alignment and structure
>1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Back     alignment and structure
>2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Back     alignment and structure
>3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Back     alignment and structure
>3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Back     alignment and structure
>2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Back     alignment and structure
>3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Back     alignment and structure
>3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Back     alignment and structure
>1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A Back     alignment and structure
>1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Back     alignment and structure
>3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} SCOP: d.32.1.0 Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Back     alignment and structure
>1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Back     alignment and structure
>3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Back     alignment and structure
>3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Back     alignment and structure
>2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Back     alignment and structure
>3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Back     alignment and structure
>3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Back     alignment and structure
>3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} Back     alignment and structure
>2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Back     alignment and structure
>1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A Back     alignment and structure
>3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Back     alignment and structure
>1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Back     alignment and structure
>2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Back     alignment and structure
>4gym_A Glyoxalase/bleomycin resistance protein/dioxygena; PSI-biology, midwest center for structural genomics, MCSG, oxidoreductase; HET: MSE; 1.56A {Conexibacter woesei} Back     alignment and structure
>2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Back     alignment and structure
>2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Back     alignment and structure
>1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Back     alignment and structure
>3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Back     alignment and structure
>2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Back     alignment and structure
>4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Back     alignment and structure
>4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Back     alignment and structure
>1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Back     alignment and structure
>1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Back     alignment and structure
>2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Back     alignment and structure
>1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Back     alignment and structure
>3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Back     alignment and structure
>1u6l_A Hypothetical protein; structural genomics, PSI, protein STRU initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.81A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>1u7i_A Hypothetical protein; structural genomics, PA1358, PSI, PROT structure initiative; HET: MSE; 1.40A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* Back     alignment and structure
>1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1tsj_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, nysgxrc; 2.60A {Staphylococcus aureus subsp} SCOP: d.32.1.7 Back     alignment and structure
>1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A Back     alignment and structure
>3l20_A Putative uncharacterized protein; hypothetical protein, unknown function; 2.45A {Staphylococcus aureus} Back     alignment and structure
>3oms_A PHNB protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, methyltransferase, GL family; 1.90A {Bacillus cereus} SCOP: d.32.1.0 Back     alignment and structure
>3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* Back     alignment and structure
>1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} Back     alignment and structure
>3p8a_A Uncharacterized protein; mainly antiparallel beta sheets, alpha and beta protein, UNK function; HET: MSE BTB PG4; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3opy_B 6-phosphofructo-1-kinase beta-subunit; ATP binding, fructose-6-phosphate bindi magnesium binding, citrate binding, ADP binding; HET: ATP; 3.05A {Pichia pastoris} Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Back     alignment and structure
>1u69_A Hypothetical protein; structural genomics, MSCG, pseudomonas aeruginosa PAO1, HYPO protein, protein structure initiative (PSI); 1.60A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Back     alignment and structure
>1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Back     alignment and structure
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Back     alignment and structure
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Back     alignment and structure
>3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* Back     alignment and structure
>3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Back     alignment and structure
>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Back     alignment and structure
>4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Back     alignment and structure
>2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Back     alignment and structure
>3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Back     alignment and structure
>3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Back     alignment and structure
>3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Back     alignment and structure
>3iuz_A Putative glyoxalase superfamily protein; struct genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: MLY P6G PGE; 1.90A {Ralstonia eutropha} Back     alignment and structure
>2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 161
d1f9za_135 d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lya 1e-09
d2c21a1139 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathion 7e-06
d1twua_137 d.32.1.8 (A:) Hypothetical protein YycE {Bacillus 3e-05
>d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Length = 135 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
family: Glyoxalase I (lactoylglutathione lyase)
domain: Glyoxalase I (lactoylglutathione lyase)
species: Escherichia coli [TaxId: 562]
 Score = 51.2 bits (121), Expect = 1e-09
 Identities = 49/116 (42%), Positives = 74/116 (63%), Gaps = 4/116 (3%)

Query: 43  QALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTDD 102
           + LGMKLLRT + PEYKY+LA +GY  E +  V+ELTYN+GV +Y  G AY  +A+S D+
Sbjct: 22  KVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVDKYELGTAYGHIALSVDN 81

Query: 103 VYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNEDFLKEI 158
             ++ E +    ++ GG +TR+ G + G  T I    DPDG+K  L++ +D  + +
Sbjct: 82  AAEACEKI----RQNGGNVTREAGPVKGGTTVIAFVEDPDGYKIELIEEKDAGRGL 133


>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Length = 139 Back     information, alignment and structure
>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Length = 137 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
d1f9za_135 Glyoxalase I (lactoylglutathione lyase) {Escherich 99.8
d1ss4a_149 Hypothetical protein BC1747 {Bacillus cereus (stra 99.76
d1jc4a_145 Methylmalonyl-CoA epimerase {Propionibacterium she 99.74
d2i7ra1115 Hypotheical protein SP0731 {Streptococcus pneumoni 99.74
d1qipa_176 Glyoxalase I (lactoylglutathione lyase) {Human (Ho 99.72
d1mpya2162 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 99.72
d1twua_137 Hypothetical protein YycE {Bacillus subtilis [TaxI 99.72
d1zswa1144 Hypothetical protein BC1024 {Bacillus cereus [TaxI 99.71
d1r9ca_130 Fosfomycin resistance protein FosX {Mesorhizobium 99.66
d1zswa2170 Hypothetical protein BC1024 {Bacillus cereus [TaxI 99.63
d1xqaa_113 Hypothetical protein BC3580 {Bacillus cereus [TaxI 99.62
d1npba_140 Fosfomycin resistance protein A (FosA) {Serratia m 99.62
d2c21a1139 Glyoxalase I (lactoylglutathione lyase) {Leishmani 99.62
d1f1ua2176 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 99.61
d1sqia1149 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 99.6
d1t47a1163 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 99.6
d1f1ua1146 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 99.6
d1klla_128 Mitomycin resistance protein D, MRD {Streptomyces 99.57
d1lgta1131 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.56
d1nkia_134 Fosfomycin resistance protein A (FosA) {Pseudomona 99.56
d2pjsa1111 Uncharacterized protein Atu1953 {Agrobacterium tum 99.56
d1mpya1145 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 99.55
d1sqda1167 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 99.54
d1kw3b1132 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.54
d1sp8a1172 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 99.52
d1kw3b2156 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 99.36
d1ecsa_120 Bleomycin resistance protein, BRP {Klebsiella pneu 99.34
d1cjxa1150 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 99.26
d1jifa_122 Bleomycin resistance protein, BRP {Streptomyces ve 99.19
d1xy7a_135 Hypothetical protein At5g48480 {Thale cress (Arabi 99.13
d1xrka_120 Bleomycin resistance protein, BRP {Streptoalloteic 99.12
d1cjxa2203 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 98.87
d1sp8a2224 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 98.82
d1u6la_137 Hypothetical protein PA1353 {Pseudomonas aeruginos 98.67
d1sqia2210 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 98.55
d1sqda2230 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 98.51
d1t47a2199 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 98.41
d1u7ia_134 Hypothetical protein PA1358 {Pseudomonas aeruginos 97.98
d1tsja_129 Hypothetical protein MW1090 {Staphylococcus aureus 96.81
d1xqaa_113 Hypothetical protein BC3580 {Bacillus cereus [TaxI 95.47
d1sqia1149 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 95.38
d1ss4a_149 Hypothetical protein BC1747 {Bacillus cereus (stra 94.69
d1t47a1163 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 94.65
d1jc4a_145 Methylmalonyl-CoA epimerase {Propionibacterium she 94.14
d1zswa1144 Hypothetical protein BC1024 {Bacillus cereus [TaxI 92.37
d1sp8a1172 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 92.1
d1sqda1167 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 90.58
d1r9ca_130 Fosfomycin resistance protein FosX {Mesorhizobium 89.92
d1qipa_176 Glyoxalase I (lactoylglutathione lyase) {Human (Ho 83.78
d1sp8a2 224 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 83.78
d1u69a_156 Hypothetical protein PA2721 {Pseudomonas aeruginos 82.99
d1mpya2162 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 82.85
d1f1ua2 176 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 82.8
d1lgta1131 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 82.1
>d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
family: Glyoxalase I (lactoylglutathione lyase)
domain: Glyoxalase I (lactoylglutathione lyase)
species: Escherichia coli [TaxId: 562]
Probab=99.80  E-value=2.3e-18  Score=118.63  Aligned_cols=123  Identities=43%  Similarity=0.774  Sum_probs=86.8

Q ss_pred             cceeEEE-eeCCc--------cccCCEEEEEEeCCCCcEEEEEeeccCCCCceEEEEeeeCCCcccccCCCeeEEEEEeC
Q 031367           31 LPLNDVV-FVGSL--------QALGMKLLRTVDKPEYKYTLAMLGYAEEDQTTVLELTYNYGVTEYTKGNAYAQVAISTD  101 (161)
Q Consensus        31 ~~i~Hv~-~V~Dl--------~vLG~~~~~~~~~~~g~~~~~~l~~~~~~~~~~leL~~~~~~~~~~~g~g~~Hiaf~V~  101 (161)
                      |++.||+ +|+|+        ++|||++..+.+...+.+..+.+...........+............+.+..|+++.++
T Consensus         1 Mkl~Hv~i~V~Dl~~s~~FY~~iLG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (135)
T d1f9za_           1 MRLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYNWGVDKYELGTAYGHIALSVD   80 (135)
T ss_dssp             CCEEEEEEECSCHHHHHHHHHHTTCCEEEEEEEETTTTEEEEEEESSCTTTSCEEEEEEETTCCCCCCCSSEEEEEEECS
T ss_pred             CcceEEEEEcCCHHHHHHHHHHHhCCEEEeeccccccceeeeeeccceeeeccccccccccccccccccccceeeccchH
Confidence            6899999 99999        89999998887766666655554433211112222212222222233457789999999


Q ss_pred             CHHHHHHHHhHHHHhcCCeeecCCcccCCCceEEEEEECCCCCEEEEEecCCchhh
Q 031367          102 DVYKSAEVVNLVTQELGGKITRQPGSIPGLNTKITSFVDPDGWKTVLVDNEDFLKE  157 (161)
Q Consensus       102 Di~~~~~~L~~~~~~~Gv~i~~~p~~~~~~~~~~~f~~DPDG~~IEl~~~~~~~~~  157 (161)
                      ++++..+++    +++|+.+..+|...+++..+++||+|||||+|||+|.+.-.++
T Consensus        81 ~~~~~~~~~----~~~g~~~~~~~~~~~~~~~~~~~~~DPdG~~iEl~q~~~~~~~  132 (135)
T d1f9za_          81 NAAEACEKI----RQNGGNVTREAGPVKGGTTVIAFVEDPDGYKIELIEEKDAGRG  132 (135)
T ss_dssp             CHHHHHHHH----HHTTCEEEEEEEECTTSCCEEEEEECTTSCEEEEEEC------
T ss_pred             HHHHHHHHH----HHcCCCeecCCccccCCCeEEEEEECCCCCEEEEEECCCcccc
Confidence            999999999    5999999988887777667899999999999999998765554



>d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Back     information, alignment and structure
>d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} Back     information, alignment and structure
>d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Back     information, alignment and structure
>d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1u7ia_ d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1u69a_ d.32.1.7 (A:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure