Citrus Sinensis ID: 031429

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MASNDDELKKKQMADARARNISRNVRCTDCGSQSIEDSQADIAILLRKLIRDEIQAGKTDKEVYKKLEDDFGETVLYAPKFDLQTAALWLSPLLVAGAAAGIWAYNRHRQKTNVHIMALNLVRGVPLTPKEKETMLDLLTPPPPQRPSPSSWWRRWRGQ
cccccHHHHccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccHHHHHHHHHHcccccccccccccHHHHcccc
****DDELKKKQMADARARNISRNVRCTDCGSQSIEDSQADIAILLRKLIRDEIQAGKTDKEVYKKLEDDFGETVLYAPKFDLQTAALWLSPLLVAGAAAGIWAYNRHRQ**********************E**************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASNDDELKKKQMADARARNISRNVRCTDCGSQSIEDSQADIAILLRKLIRDEIQAGKTDKEVYKKLEDDFGETVLYAPKFDLQTAALWLSPLLVAGAAAGIWAYNRHRQKTNVHIMALNLVRGVPLTPKEKETMLDLLTPPPPQRPSPSSWWRRWRGQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome c-type biogenesis protein CcmH Required for the biogenesis of c-type cytochromes. Possible subunit of a heme lyase.probableP45406

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KW0, chain A
Confidence level:very confident
Coverage over the Query: 5-83
View the alignment between query and template
View the model in PyMOL