Citrus Sinensis ID: 031432

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16

MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKDIGPK

ccccccccccccccccccCEEEEcccccccCEEEEcccEEEEEEEEEcccccccccEEEEEEEEcccccEEEEEEccccEEEccCEEEcEEEEEEEccccEEEEEEccccCEEECcccccHHHHHHHHHHHcccccEEEEEEccccEEEEEEEcccccc

******************TFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKDIG**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSDEEHHFESKADAGASKTFPQQAGTIRKNGYIVIKGRPCKVVEVSTSKTGKHGHAKCHFVGIDIFNGKKLEDIVPSSHNCDVPHVTRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDENLLSQIKDGFESGKDLVVSVQCAMGEEQINALKDIGPK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Eukaryotic translation initiation factor 5A-4	The precise role of eIF-5A in protein biosynthesis is not known but it functions by promoting the formation of the first peptide bond.	confident	P56336
Eukaryotic translation initiation factor 5A-3	The precise role of eIF-5A in protein biosynthesis is not known but it functions by promoting the formation of the first peptide bond.	confident	P56335
Eukaryotic translation initiation factor 5A-2	The precise role of eIF-5A in protein biosynthesis is not known but it functions by promoting the formation of the first peptide bond.	confident	P24922

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HKS, chain A
Confidence level:very confident
Coverage over the Query: 17-158
View the alignment between query and template
View the model in PyMOL