Citrus Sinensis ID: 031473

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16

MGWKAAEKLIRHWKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVKKHIKGGEGHEGGIFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSIIPRPEILKIRTTPRPTVAGPKDTPVDLVMKKTYDAKSGKGMPDL

ccccHHHHHccccEEEcccEEEEEcccccccccEEEEEEccccEEEEEcccEEEEECcccccccccEEEEECccccccEEEEcccccccEEEEEEEcccccEEEEEEccccccEECcccccccccccccccccccccccHHHHHHHccccccccccccc

****AAEKLIRHWKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVKKHIKGGEGHEGGIFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSIIPRPEILKIRT********PKDTPVDLVMKKTYDAKSGK*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGWKAAEKLIRHWKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVKKHIKGGEGHEGGIFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSIIPRPEILKIRTTPRPTVAGPKDTPVDLVMKKTYDAKSGKGMPDL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
50S ribosomal protein L24	One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit.	probable	B9E9K2
50S ribosomal protein L24	One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit.	probable	A7IPQ9
50S ribosomal protein L24	One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit.	probable	Q9ZCR6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain W
Confidence level:very confident
Coverage over the Query: 15-120
View the alignment between query and template
View the model in PyMOL