Citrus Sinensis ID: 031473

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MGWKAAEKLIRHWKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVKKHIKGGEGHEGGIFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSIIPRPEILKIRTTPRPTVAGPKDTPVDLVMKKTYDAKSGKGMPDL
ccccHHHHHccccEEEcccEEEEEcccccccccEEEEEEccccEEEEEcccEEEEEEcccccccccEEEEEEccccccEEEEcccccccEEEEEEEcccccEEEEEEccccccEEEcccccccccccccccccccccccHHHHHHHHcccccccccccc
cccEEEEccHHHcEEEcccEEEEEEEccccccEEEEEEEccccEEEEEcEEEEEEEccccccccccEEEEcccEEEEEEEEEcccccccEEEEEEEEccccEEEEEEccccEEEEccccHHHHHcccccccccccccccHHHHHHHccccccccccccc
MGWKAAEKLIRHWKilrgdnvmiirgkdkgetgAIKRVIRSQNRVIVEGKNLVKKhikggegheggiftveapihasnvqvldpvtgkpckvgtkyledgtKVRVArgigasgsiiprpeilkirttprptvagpkdtpvdLVMKKtydaksgkgmpdl
MGWKAAEKLIRhwkilrgdnvmiirgkdkgetgaikrvirsqnrvivegknlvkkhikggEGHEGGIFTVEAPIHASnvqvldpvtgkpCKVGtkyledgtkvrvargigasgsiiprpeilkirttprptvagpkdtpvdlvmkktydaksgkgmpdl
MGWKAAEKLIRHWKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVkkhikggegheggiFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSIIPRPEILKIRTTPRPTVAGPKDTPVDLVMKKTYDAKSGKGMPDL
****AAEKLIRHWKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVKKHIKGGEGHEGGIFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSIIPRPEILKIR**********************************
**********RHWKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVKKH************TVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSIIPRPEILKIRT********PKDTPVDLVMKKTYDAKSGKGMPDL
MGWKAAEKLIRHWKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVKKHIKGGEGHEGGIFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSIIPRPEILKIRTTPRPTVAGPKDTPVDLVMKKTYD**********
*GWKAAEKLIRHWKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVKKHIKGGEGHEGGIFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSIIPRPEILKIRTTPRPTVAGPKDTPVDLVMKKTYDAKSGK*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGWKAAEKLIRHWKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVKKHIKGGEGHEGGIFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSIIPRPEILKIRTTPRPTVAGPKDTPVDLVMKKTYDAKSGKGMPDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query159 2.2.26 [Sep-21-2011]
Q47LK4101 50S ribosomal protein L24 yes no 0.603 0.950 0.51 3e-20
B9DM36105 50S ribosomal protein L24 yes no 0.597 0.904 0.515 7e-20
B6IRR7105 50S ribosomal protein L24 yes no 0.628 0.952 0.524 8e-20
A8LC45108 50S ribosomal protein L24 yes no 0.622 0.916 0.475 9e-20
A9VP88103 50S ribosomal protein L24 yes no 0.584 0.902 0.578 1e-19
Q6HPP7103 50S ribosomal protein L24 yes no 0.584 0.902 0.568 2e-19
Q63H79103 50S ribosomal protein L24 yes no 0.584 0.902 0.568 2e-19
Q81J31103 50S ribosomal protein L24 yes no 0.584 0.902 0.568 2e-19
B9IZK5103 50S ribosomal protein L24 yes no 0.584 0.902 0.568 2e-19
B7HQV5103 50S ribosomal protein L24 yes no 0.584 0.902 0.568 2e-19
>sp|Q47LK4|RL24_THEFY 50S ribosomal protein L24 OS=Thermobifida fusca (strain YX) GN=rplX PE=3 SV=1 Back     alignment and function desciption
 Score = 97.4 bits (241), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 71/100 (71%), Gaps = 4/100 (4%)

Query: 13  WKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVKKHIKGGE--GHEGGIFTV 70
            KI +GD V++I GKDKG TG +K+ +  + RVIVEG NL+KKH K  +  G +G + T+
Sbjct: 1   MKIKKGDEVIVIAGKDKGATGKVKKALPKEQRVIVEGVNLIKKHKKANQAGGQQGEVVTL 60

Query: 71  EAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIG 110
           EAPIH SNV +L+   G+P +VG ++ EDGTKVR++R  G
Sbjct: 61  EAPIHVSNVALLED--GRPTRVGYRFKEDGTKVRISRRTG 98
One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit.
Thermobifida fusca (strain YX) (taxid: 269800)
>sp|B9DM36|RL24_STACT 50S ribosomal protein L24 OS=Staphylococcus carnosus (strain TM300) GN=rplX PE=3 SV=1 Back     alignment and function description
>sp|B6IRR7|RL24_RHOCS 50S ribosomal protein L24 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rplX PE=3 SV=1 Back     alignment and function description
>sp|A8LC45|RL24_FRASN 50S ribosomal protein L24 OS=Frankia sp. (strain EAN1pec) GN=rplX PE=3 SV=1 Back     alignment and function description
>sp|A9VP88|RL24_BACWK 50S ribosomal protein L24 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rplX PE=3 SV=1 Back     alignment and function description
>sp|Q6HPP7|RL24_BACHK 50S ribosomal protein L24 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rplX PE=3 SV=1 Back     alignment and function description
>sp|Q63H79|RL24_BACCZ 50S ribosomal protein L24 OS=Bacillus cereus (strain ZK / E33L) GN=rplX PE=3 SV=1 Back     alignment and function description
>sp|Q81J31|RL24_BACCR 50S ribosomal protein L24 OS=Bacillus cereus (strain ATCC 14579 / DSM 31) GN=rplX PE=3 SV=1 Back     alignment and function description
>sp|B9IZK5|RL24_BACCQ 50S ribosomal protein L24 OS=Bacillus cereus (strain Q1) GN=rplX PE=3 SV=1 Back     alignment and function description
>sp|B7HQV5|RL24_BACC7 50S ribosomal protein L24 OS=Bacillus cereus (strain AH187) GN=rplX PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
255584484159 mitochondrial ribosomal protein L24, put 1.0 1.0 0.911 1e-78
388521335159 unknown [Medicago truncatula] 1.0 1.0 0.899 1e-78
224079013159 predicted protein [Populus trichocarpa] 1.0 1.0 0.893 3e-78
351727957159 uncharacterized protein LOC100305917 [Gl 1.0 1.0 0.899 1e-77
388492602159 unknown [Lotus japonicus] 1.0 1.0 0.886 1e-76
351720752159 uncharacterized protein LOC100499816 [Gl 1.0 1.0 0.886 1e-76
22327012159 50S ribosomal protein L24-like protein [ 1.0 1.0 0.880 1e-75
255567548159 mitochondrial ribosomal protein L24, put 1.0 1.0 0.861 1e-75
194462395159 ribosomal protein L24 [Cucumis melo var. 1.0 1.0 0.867 2e-75
297821761159 KOW domain-containing protein [Arabidops 1.0 1.0 0.874 8e-75
>gi|255584484|ref|XP_002532971.1| mitochondrial ribosomal protein L24, putative [Ricinus communis] gi|223527249|gb|EEF29408.1| mitochondrial ribosomal protein L24, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 155/159 (97%)

Query: 1   MGWKAAEKLIRHWKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVKKHIKGG 60
           MGWKAAEKLIRHWK+LRGDNV+IIRGKDKGETG IKRVIRSQNRVIVEGKNLVKKHIK G
Sbjct: 1   MGWKAAEKLIRHWKVLRGDNVIIIRGKDKGETGIIKRVIRSQNRVIVEGKNLVKKHIKAG 60

Query: 61  EGHEGGIFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSIIPRPE 120
           EGHEGGIFTVEAP+HASNVQVLDPVTGKPCKVG +YLEDGTKVRV+RGIGASGSIIPRPE
Sbjct: 61  EGHEGGIFTVEAPLHASNVQVLDPVTGKPCKVGYRYLEDGTKVRVSRGIGASGSIIPRPE 120

Query: 121 ILKIRTTPRPTVAGPKDTPVDLVMKKTYDAKSGKGMPDL 159
           ILKIRTTPRPT AGPKDTP+DLV+++TYDAK+GKGMPDL
Sbjct: 121 ILKIRTTPRPTEAGPKDTPIDLVLERTYDAKTGKGMPDL 159

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|388521335|gb|AFK48729.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|224079013|ref|XP_002305718.1| predicted protein [Populus trichocarpa] gi|222848682|gb|EEE86229.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351727957|ref|NP_001238714.1| uncharacterized protein LOC100305917 [Glycine max] gi|255626969|gb|ACU13829.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388492602|gb|AFK34367.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|351720752|ref|NP_001236419.1| uncharacterized protein LOC100499816 [Glycine max] gi|255626857|gb|ACU13773.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|22327012|ref|NP_680212.1| 50S ribosomal protein L24-like protein [Arabidopsis thaliana] gi|297808355|ref|XP_002872061.1| KOW domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|8809706|dbj|BAA97247.1| 50S ribosomal protein L24 [Arabidopsis thaliana] gi|44681334|gb|AAS47607.1| At5g23535 [Arabidopsis thaliana] gi|45773844|gb|AAS76726.1| At5g23535 [Arabidopsis thaliana] gi|110735795|dbj|BAE99874.1| 50S ribosomal protein L24 [Arabidopsis thaliana] gi|297317898|gb|EFH48320.1| KOW domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|332005797|gb|AED93180.1| 50S ribosomal protein L24-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255567548|ref|XP_002524753.1| mitochondrial ribosomal protein L24, putative [Ricinus communis] gi|223535937|gb|EEF37596.1| mitochondrial ribosomal protein L24, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|194462395|gb|ACF72672.1| ribosomal protein L24 [Cucumis melo var. cantalupensis] Back     alignment and taxonomy information
>gi|297821761|ref|XP_002878763.1| KOW domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297324602|gb|EFH55022.1| KOW domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
TAIR|locus:504954880159 AT5G23535 [Arabidopsis thalian 1.0 1.0 0.805 7.4e-66
DICTYBASE|DDB_G0269640164 DDB_G0269640 "39S ribosomal pr 0.861 0.835 0.401 3.9e-21
UNIPROTKB|Q3SYS0216 MRPL24 "39S ribosomal protein 0.836 0.615 0.357 7.5e-18
UNIPROTKB|F1RHJ1216 MRPL24 "Uncharacterized protei 0.836 0.615 0.364 1.2e-17
ZFIN|ZDB-GENE-040718-98216 mrpl24 "mitochondrial ribosoma 0.836 0.615 0.343 1.6e-17
TIGR_CMR|BA_0121103 BA_0121 "ribosomal protein L24 0.597 0.922 0.484 2.5e-17
MGI|MGI:1914957216 Mrpl24 "mitochondrial ribosoma 0.836 0.615 0.343 8.6e-17
RGD|1359289216 mrpl24 "mitochondrial ribosoma 0.836 0.615 0.343 1.1e-16
TIGR_CMR|CHY_2298107 CHY_2298 "ribosomal protein L2 0.622 0.925 0.44 1.4e-16
UNIPROTKB|Q96A35216 MRPL24 "39S ribosomal protein 0.836 0.615 0.343 1.8e-16
TAIR|locus:504954880 AT5G23535 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 670 (240.9 bits), Expect = 7.4e-66, P = 7.4e-66
 Identities = 128/159 (80%), Positives = 137/159 (86%)

Query:     1 MGWKAAEKLIRHWKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVXXXXXXX 60
             MGWKAAEKLIRHWKILRGDNVMIIRGKDKGETG IKRVIRSQNRVIVEGKNL+       
Sbjct:     1 MGWKAAEKLIRHWKILRGDNVMIIRGKDKGETGTIKRVIRSQNRVIVEGKNLIKKHIKGG 60

Query:    61 XXXXXXXFTVEAPIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSIIPRPE 120
                    FTVEAP+HASNVQV+DPVTG+PCKVG KYLEDGTKVRVARG G SGSIIPRPE
Sbjct:    61 PDHEGGIFTVEAPLHASNVQVVDPVTGRPCKVGVKYLEDGTKVRVARGTGTSGSIIPRPE 120

Query:   121 ILKIRTTPRPTVAGPKDTPVDLVMKKTYDAKSGKGMPDL 159
             ILKIR TPRPT AGPKDTP++ V ++TYDAK+GKGMPDL
Sbjct:   121 ILKIRATPRPTTAGPKDTPMEFVWEQTYDAKTGKGMPDL 159
GO:0003735 "structural constituent of ribosome" evidence=IEA;ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0005840 "ribosome" evidence=IEA
GO:0006412 "translation" evidence=IEA;ISS
GO:0015934 "large ribosomal subunit" evidence=ISS
DICTYBASE|DDB_G0269640 DDB_G0269640 "39S ribosomal protein L24, mitochondrial" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SYS0 MRPL24 "39S ribosomal protein L24, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RHJ1 MRPL24 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-98 mrpl24 "mitochondrial ribosomal protein L24" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0121 BA_0121 "ribosomal protein L24" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
MGI|MGI:1914957 Mrpl24 "mitochondrial ribosomal protein L24" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1359289 mrpl24 "mitochondrial ribosomal protein L24" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2298 CHY_2298 "ribosomal protein L24" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|Q96A35 MRPL24 "39S ribosomal protein L24, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZCR6RL24_RICPRNo assigned EC number0.52880.63520.8938yesno
B9E9K2RL24_MACCJNo assigned EC number0.54360.61630.9607yesno
A7IPQ9RL24_XANP2No assigned EC number0.50510.61000.9238yesno
Q47LK4RL24_THEFYNo assigned EC number0.510.60370.9504yesno
B6IRR7RL24_RHOCSNo assigned EC number0.52420.62890.9523yesno
A5VLJ4RL24_LACRDNo assigned EC number0.53530.61000.9509yesno
B2G8W7RL24_LACRJNo assigned EC number0.53530.61000.9509yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
PRK00004105 PRK00004, rplX, 50S ribosomal protein L24; Reviewe 4e-36
TIGR01079104 TIGR01079, rplX_bact, ribosomal protein L24, bacte 1e-28
cd0608965 cd06089, KOW_RPL26, KOW motif of Ribosomal Protein 7e-21
COG0198104 COG0198, RplX, Ribosomal protein L24 [Translation, 7e-21
CHL0014183 CHL00141, rpl24, ribosomal protein L24; Validated 5e-17
PRK1228176 PRK12281, rplX, 50S ribosomal protein L24; Reviewe 1e-15
PRK01191120 PRK01191, rpl24p, 50S ribosomal protein L24P; Vali 1e-05
pfam0046732 pfam00467, KOW, KOW motif 2e-05
TIGR01080114 TIGR01080, rplX_A_E, ribosomal protein L24p/L26e, 3e-04
PTZ00194143 PTZ00194, PTZ00194, 60S ribosomal protein L26; Pro 0.003
smart0073928 smart00739, KOW, KOW (Kyprides, Ouzounis, Woese) m 0.003
>gnl|CDD|234566 PRK00004, rplX, 50S ribosomal protein L24; Reviewed Back     alignment and domain information 
 Score =  120 bits (303), Expect = 4e-36
 Identities = 54/95 (56%), Positives = 70/95 (73%), Gaps = 1/95 (1%)

Query: 14  KILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVKKHIK-GGEGHEGGIFTVEA 72
           KI +GD V++I GKDKG+ G + +V+  +N+VIVEG N+VKKH K   E  +GGI   EA
Sbjct: 4   KIKKGDTVIVIAGKDKGKRGKVLKVLPKKNKVIVEGVNIVKKHQKPNQENPQGGIIEKEA 63

Query: 73  PIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVAR 107
           PIH SNV ++DP TGK  +VG K+LEDG KVRVA+
Sbjct: 64  PIHISNVALVDPKTGKATRVGFKFLEDGKKVRVAK 98

Length = 105
>gnl|CDD|233263 TIGR01079, rplX_bact, ribosomal protein L24, bacterial/organelle Back     alignment and domain information
>gnl|CDD|240513 cd06089, KOW_RPL26, KOW motif of Ribosomal Protein L26 Back     alignment and domain information
>gnl|CDD|223276 COG0198, RplX, Ribosomal protein L24 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|214374 CHL00141, rpl24, ribosomal protein L24; Validated Back     alignment and domain information
>gnl|CDD|183399 PRK12281, rplX, 50S ribosomal protein L24; Reviewed Back     alignment and domain information
>gnl|CDD|234915 PRK01191, rpl24p, 50S ribosomal protein L24P; Validated Back     alignment and domain information
>gnl|CDD|144165 pfam00467, KOW, KOW motif Back     alignment and domain information
>gnl|CDD|130152 TIGR01080, rplX_A_E, ribosomal protein L24p/L26e, archaeal/eukaryotic Back     alignment and domain information
>gnl|CDD|185508 PTZ00194, PTZ00194, 60S ribosomal protein L26; Provisional Back     alignment and domain information
>gnl|CDD|128978 smart00739, KOW, KOW (Kyprides, Ouzounis, Woese) motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 159
PRK00004105 rplX 50S ribosomal protein L24; Reviewed 100.0
TIGR01079104 rplX_bact ribosomal protein L24, bacterial/organel 100.0
KOG1708236 consensus Mitochondrial/chloroplast ribosomal prot 100.0
COG0198104 RplX Ribosomal protein L24 [Translation, ribosomal 99.97
CHL0014183 rpl24 ribosomal protein L24; Validated 99.93
PRK1228176 rplX 50S ribosomal protein L24; Reviewed 99.92
PRK01191120 rpl24p 50S ribosomal protein L24P; Validated 99.86
PTZ00194143 60S ribosomal protein L26; Provisional 99.85
TIGR01080114 rplX_A_E ribosomal protein L24p/L26e, archaeal/euk 99.8
KOG3401145 consensus 60S ribosomal protein L26 [Translation, 98.89
PF0046732 KOW: KOW motif; InterPro: IPR005824 Ribosomes are 98.85
smart0073928 KOW KOW (Kyprides, Ouzounis, Woese) motif. Motif i 97.96
PRK08559153 nusG transcription antitermination protein NusG; V 97.56
TIGR00405145 L26e_arch ribosomal protein L24p/L26e, archaeal. T 97.37
COG0250178 NusG Transcription antiterminator [Transcription] 97.19
PRK05609181 nusG transcription antitermination protein NusG; V 96.98
TIGR00922172 nusG transcription termination/antitermination fac 96.96
TIGR01955159 RfaH transcriptional activator RfaH. This model re 96.27
PRK09014162 rfaH transcriptional activator RfaH; Provisional 96.1
TIGR01956258 NusG_myco NusG family protein. This model represen 96.07
PRK0433384 50S ribosomal protein L14e; Validated 93.5
PTZ00065130 60S ribosomal protein L14; Provisional 88.99
PRK04313237 30S ribosomal protein S4e; Validated 87.32
PTZ00471134 60S ribosomal protein L27; Provisional 87.3
COG2163125 RPL14A Ribosomal protein L14E/L6E/L27E [Translatio 84.74
KOG1999 1024 consensus RNA polymerase II transcription elongati 84.61
PRK06531113 yajC preprotein translocase subunit YajC; Validate 82.82
COG1471241 RPS4A Ribosomal protein S4E [Translation, ribosoma 81.54
>PRK00004 rplX 50S ribosomal protein L24; Reviewed Back     alignment and domain information 
Probab=100.00  E-value=1.5e-33  Score=206.09  Aligned_cols=99  Identities=55%  Similarity=0.871  Sum_probs=94.2

Q ss_pred             hcccccCCEEEEeecCCCCcEeeEEEEEccCCEEEEeccceeeeeeCCCC-CCCCceEEEeeeccCCCccccCCCCCCce
Q 031473           12 HWKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVKKHIKGGE-GHEGGIFTVEAPIHASNVQVLDPVTGKPC   90 (159)
Q Consensus        12 ~~~i~kGD~V~Vi~G~dKGk~G~V~~V~~~~~~V~Vegvn~~~~~~k~~~-~~~g~i~~~e~pI~~SnV~Lvdp~~g~~~   90 (159)
                      .|+|++||+|+||+|+|||++|+|++|++++++|+|||+|+.++|+++++ +.+|+++++|+|||+|||+|+||.+++++
T Consensus         2 ~~~i~kGD~V~Vi~G~dKGk~G~V~~V~~~~~~V~Vegvn~~k~h~k~~~~~~~G~i~~~e~pI~~SnV~lv~p~~~~~~   81 (105)
T PRK00004          2 MMKIKKGDTVIVIAGKDKGKRGKVLKVLPKKNKVIVEGVNIVKKHQKPNQENPQGGIIEKEAPIHISNVALVDPKTGKAT   81 (105)
T ss_pred             CCcccCCCEEEEeEcCCCCcEEEEEEEEcCCCEEEEcCcEEEEEecCCCCCCCCCceEEEECCcCHHHEEEEeCcCCCCe
Confidence            57999999999999999999999999999999999999999999999875 66899999999999999999999999999


Q ss_pred             eEEEEEccCCcEEEEEEecC
Q 031473           91 KVGTKYLEDGTKVRVARGIG  110 (159)
Q Consensus        91 rV~~~~~~~g~k~R~~k~~~  110 (159)
                      ||+|+++++|+++|+|++|+
T Consensus        82 rv~~~~~~~g~kvRv~k~~g  101 (105)
T PRK00004         82 RVGFKFLEDGKKVRVAKKSG  101 (105)
T ss_pred             EEEEEEccCCcEEEEEecCC
Confidence            99999999999999999654

>TIGR01079 rplX_bact ribosomal protein L24, bacterial/organelle Back     alignment and domain information
>KOG1708 consensus Mitochondrial/chloroplast ribosomal protein L24 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0198 RplX Ribosomal protein L24 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00141 rpl24 ribosomal protein L24; Validated Back     alignment and domain information
>PRK12281 rplX 50S ribosomal protein L24; Reviewed Back     alignment and domain information
>PRK01191 rpl24p 50S ribosomal protein L24P; Validated Back     alignment and domain information
>PTZ00194 60S ribosomal protein L26; Provisional Back     alignment and domain information
>TIGR01080 rplX_A_E ribosomal protein L24p/L26e, archaeal/eukaryotic Back     alignment and domain information
>KOG3401 consensus 60S ribosomal protein L26 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00467 KOW: KOW motif; InterPro: IPR005824 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>smart00739 KOW KOW (Kyprides, Ouzounis, Woese) motif Back     alignment and domain information
>PRK08559 nusG transcription antitermination protein NusG; Validated Back     alignment and domain information
>TIGR00405 L26e_arch ribosomal protein L24p/L26e, archaeal Back     alignment and domain information
>COG0250 NusG Transcription antiterminator [Transcription] Back     alignment and domain information
>PRK05609 nusG transcription antitermination protein NusG; Validated Back     alignment and domain information
>TIGR00922 nusG transcription termination/antitermination factor NusG Back     alignment and domain information
>TIGR01955 RfaH transcriptional activator RfaH Back     alignment and domain information
>PRK09014 rfaH transcriptional activator RfaH; Provisional Back     alignment and domain information
>TIGR01956 NusG_myco NusG family protein Back     alignment and domain information
>PRK04333 50S ribosomal protein L14e; Validated Back     alignment and domain information
>PTZ00065 60S ribosomal protein L14; Provisional Back     alignment and domain information
>PRK04313 30S ribosomal protein S4e; Validated Back     alignment and domain information
>PTZ00471 60S ribosomal protein L27; Provisional Back     alignment and domain information
>COG2163 RPL14A Ribosomal protein L14E/L6E/L27E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1999 consensus RNA polymerase II transcription elongation factor DSIF/SUPT5H/SPT5 [Transcription] Back     alignment and domain information
>PRK06531 yajC preprotein translocase subunit YajC; Validated Back     alignment and domain information
>COG1471 RPS4A Ribosomal protein S4E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
2j01_Y110 Structure Of The Thermus Thermophilus 70s Ribosome 7e-12
3mrz_U109 Recognition Of The Amber Stop Codon By Release Fact 8e-12
3tve_U102 Crystal Structure Analysis Of Ribosomal Decoding. T 9e-12
3pyo_U100 Crystal Structure Of A Complex Containing Domain 3 2e-11
3fin_Y101 T. Thermophilus 70s Ribosome In Complex With Mrna, 2e-11
1vs6_U104 Crystal Structure Of The Bacterial Ribosome From Es 4e-09
3e1b_O103 Structure Of The 50s Subunit Of E. Coli Ribosome In 4e-09
2j28_U102 Model Of E. Coli Srp Bound To 70s Rncs Length = 102 4e-09
1p85_S103 Real Space Refined Coordinates Of The 50s Subunit F 4e-09
2gya_S99 Structure Of The 50s Subunit Of A Pre-Translocation 4e-09
2ftc_N96 Structural Model For The Large Subunit Of The Mamma 4e-08
1nkw_S115 Crystal Structure Of The Large Ribosomal Subunit Fr 1e-07
1pnu_S113 Crystal Structure Of A Streptomycin Dependent Ribos 1e-07
3bbo_W191 Homology Model For The Spinach Chloroplast 50s Subu 3e-05
>pdb|2J01|Y Chain Y, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 2 Of 4). This File Contains The 50s Subunit From Molecule I. Length = 110 Back     alignment and structure 
Iteration: 1

 Score = 66.2 bits (160), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 54/99 (54%), Gaps = 1/99 (1%)
Query: 15  ILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVXXXXXXXXXXXXXXFTV-EAP 73
           + +GD V++  GK KG  G +K V+  +  VIVEG N+V              F   EAP
Sbjct: 7   VKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRVSPKYPQGGFIEKEAP 66
Query: 74  IHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGAS 112
           +HAS V+ + P  GKP +V  K+LE+G K+RV    G +
Sbjct: 67  LHASKVRPICPACGKPTRVRKKFLENGKKIRVCAKCGGA 105
>pdb|3MRZ|U Chain U, Recognition Of The Amber Stop Codon By Release Factor Rf1. This Entry 3mrz Contains 50s Ribosomal Subunit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 3ms0. Molecule A In The Same Asymmetric Unit Is Deposited As 3mr8 (50s) And 3ms1 (30s). Length = 109 Back     alignment and structure
>pdb|3TVE|U Chain U, Crystal Structure Analysis Of Ribosomal Decoding. This Entry Contains The 50s Ribosomal Subunit Of The First 70s Molecule In The Asymmetric Unit For The Cognate Trna-Leu Complex Length = 102 Back     alignment and structure
>pdb|3PYO|U Chain U, Crystal Structure Of A Complex Containing Domain 3 From The Psiv Igr Ires Rna Bound To The 70s Ribosome. This File Contains The 50s Subunit Of The First 70s Ribosome. Length = 100 Back     alignment and structure
>pdb|3FIN|Y Chain Y, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef- Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 50s Subunit Length = 101 Back     alignment and structure
>pdb|1VS6|U Chain U, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 50s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 104 Back     alignment and structure
>pdb|3E1B|O Chain O, Structure Of The 50s Subunit Of E. Coli Ribosome In Pre-Accommodation State Length = 103 Back     alignment and structure
>pdb|2J28|U Chain U, Model Of E. Coli Srp Bound To 70s Rncs Length = 102 Back     alignment and structure
>pdb|1P85|S Chain S, Real Space Refined Coordinates Of The 50s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 103 Back     alignment and structure
>pdb|2GYA|S Chain S, Structure Of The 50s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 99 Back     alignment and structure
>pdb|2FTC|N Chain N, Structural Model For The Large Subunit Of The Mammalian Mitochondrial Ribosome Length = 96 Back     alignment and structure
>pdb|1NKW|S Chain S, Crystal Structure Of The Large Ribosomal Subunit From Deinococcus Radiodurans Length = 115 Back     alignment and structure
>pdb|1PNU|S Chain S, Crystal Structure Of A Streptomycin Dependent Ribosome From Escherichia Coli, 50s Subunit Of 70s Ribosome. This File, 1pnu, Contains Only Molecules Of The 50s Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna, And A-Site Trna Are In The Pdb File 1pns. Length = 113 Back     alignment and structure
>pdb|3BBO|W Chain W, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 191 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
3bbo_W191 Ribosomal protein L24; large ribosomal subunit, sp 6e-45
2ftc_N96 Mitochondrial ribosomal protein L24; mitochondrial 6e-39
3v2d_Y110 50S ribosomal protein L24; ribosome associated inh 2e-35
2zjr_R115 50S ribosomal protein L24; ribosome, large ribosom 1e-32
3r8s_U102 50S ribosomal protein L24; protein biosynthesis, R 2e-31
1vq8_T120 50S ribosomal protein L24P; ribosome 50S, protein- 2e-15
3iz5_Y150 60S ribosomal protein L26 (L24P); eukaryotic ribos 5e-10
4a17_S135 RPL26, 60S ribosomal protein L21; eukaryotic ribos 1e-08
3u5e_Y127 L33, YL33, 60S ribosomal protein L26-A; translatio 8e-08
2zkr_t145 60S ribosomal protein L26; protein-RNA complex, 60 5e-05
>3bbo_W Ribosomal protein L24; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 191 Back     alignment and structure
 Score =  144 bits (366), Expect = 6e-45
 Identities = 39/127 (30%), Positives = 61/127 (48%), Gaps = 4/127 (3%)

Query: 13  WKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVKKHIK-GGEGHEGGIFTVE 71
             +  GD V +I G +KG+ G I ++ +  + VI++  N   KH+K   EG +G I  +E
Sbjct: 67  RHVKVGDTVKVISGGEKGKIGEISKIHKHNSTVIIKDLNFKTKHVKSKEEGEQGQIIKIE 126

Query: 72  APIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVARGIGASGSIIPRPEILKIRTTPRPT 131
           A IH+SNV ++        +VG K LED  KVR       +G I+  P+  K     + +
Sbjct: 127 AAIHSSNVMLILKEQEVADRVGHKILEDVRKVRYLI---KTGEIVDTPDRWKEIQNKKES 183

Query: 132 VAGPKDT 138
                  
Sbjct: 184 ETAVAVA 190
>2ftc_N Mitochondrial ribosomal protein L24; mitochondrial ribosome, large ribosomal subunit, ribosomal R ribosome; 12.10A {Bos taurus} PDB: 3iy9_N Length = 96 Back     alignment and structure
>3v2d_Y 50S ribosomal protein L24; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 1vsp_S 2hgj_X 2hgq_X 2hgu_X 1vsa_S 2j03_Y 2jl6_Y 2jl8_Y 2v47_Y 2v49_Y 2wdi_Y 2wdj_Y 2wdl_Y 2wdn_Y 2wh2_Y 2wh4_Y 2wrj_Y 2wrl_Y 2wro_Y 2wrr_Y ... Length = 110 Back     alignment and structure
>2zjr_R 50S ribosomal protein L24; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.34.5.1 PDB: 1nwx_S* 1nwy_S* 1sm1_S* 1xbp_S* 2d3o_S 2zjp_R* 2zjq_R 1nkw_S 3cf5_R* 3dll_R* 3pio_R* 3pip_R* 1pnu_S 1pny_S 1vor_V 1vou_V 1vow_V 1voy_V 1vp0_V Length = 115 Back     alignment and structure
>3r8s_U 50S ribosomal protein L24; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 2j28_U* 3fik_U 2wwq_U 3oat_U* 3oas_U* 3ofd_U 3ofc_U 3ofr_U* 3ofz_U* 3og0_U 3ofq_U 3r8t_U 3i1n_U 1vs8_U 1vs6_U 1vt2_U 3i1p_U 3i1r_U 3i1t_U 3i20_U ... Length = 102 Back     alignment and structure
>1vq8_T 50S ribosomal protein L24P; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: b.34.5.1 PDB: 1vq4_T* 1vq5_T* 1vq6_T* 1vq7_T* 1s72_T* 1vq9_T* 1vqk_T* 1vql_T* 1vqm_T* 1vqn_T* 1vqo_T* 1vqp_T* 1yhq_T* 1yi2_T* 1yij_T* 1yit_T* 1yj9_T* 1yjn_T* 1yjw_T* 2otj_T* ... Length = 120 Back     alignment and structure
>4a17_S RPL26, 60S ribosomal protein L21; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_S 4a1c_S 4a1e_S Length = 135 Back     alignment and structure
>3u5e_Y L33, YL33, 60S ribosomal protein L26-A; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 2wwa_L 2ww9_L 2wwb_L 3o5h_X 3o58_X 3u5i_Y 1s1i_U 3izc_Y 3izs_Y 3jyw_U Length = 127 Back     alignment and structure
>2zkr_t 60S ribosomal protein L26; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 145 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
3v2d_Y110 50S ribosomal protein L24; ribosome associated inh 100.0
3r8s_U102 50S ribosomal protein L24; protein biosynthesis, R 100.0
2ftc_N96 Mitochondrial ribosomal protein L24; mitochondrial 100.0
2zjr_R115 50S ribosomal protein L24; ribosome, large ribosom 100.0
3bbo_W191 Ribosomal protein L24; large ribosomal subunit, sp 100.0
1vq8_T120 50S ribosomal protein L24P; ribosome 50S, protein- 99.9
3j21_U121 50S ribosomal protein L24P; archaea, archaeal, KIN 99.9
2zkr_t145 60S ribosomal protein L26; protein-RNA complex, 60 99.86
3u5e_Y127 L33, YL33, 60S ribosomal protein L26-A; translatio 99.86
3iz5_Y150 60S ribosomal protein L26 (L24P); eukaryotic ribos 99.85
4a17_S135 RPL26, 60S ribosomal protein L21; eukaryotic ribos 99.85
1nz9_A58 Transcription antitermination protein NUSG; transc 98.44
3p8b_B152 Transcription antitermination protein NUSG; transc 97.72
2e6z_A59 Transcription elongation factor SPT5; KOW motif, s 97.49
2jvv_A181 Transcription antitermination protein NUSG; transc 97.04
2do3_A69 Transcription elongation factor SPT5; KOW motif, s 96.83
2ckk_A127 KIN17; beta barrel, ribosomal protein, ribonucleop 96.68
2xhc_A352 Transcription antitermination protein NUSG; 2.45A 96.11
1m1h_A248 Transcription antitermination protein NUSG; transc 95.55
4a18_F126 RPL14; ribosome, eukaryotic initiation factor 6, E 93.47
3iz5_N134 60S ribosomal protein L14 (L14E); eukaryotic ribos 92.51
2joy_A96 50S ribosomal protein L14E; protein solution struc 92.12
2e70_A71 Transcription elongation factor SPT5; KOW motif, s 91.78
3izc_N138 60S ribosomal protein RPL14 (L14E); eukaryotic rib 90.83
4a18_N144 RPL27, ribosomal protein L22; ribosome, eukaryotic 90.39
3j21_583 50S ribosomal protein L14E; archaea, archaeal, KIN 90.21
4a18_E191 RPL6; ribosome, eukaryotic initiation factor 6, EI 86.25
3iz6_D265 40S ribosomal protein S4 (S4E); eukaryotic ribosom 84.45
3iz5_G219 60S ribosomal protein L6 (L6E); eukaryotic ribosom 82.75
1qp2_A70 Protein (PSAE protein); mainly beta, roll, pleckst 81.42
>3v2d_Y 50S ribosomal protein L24; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 1vsp_S 2hgj_X 2hgq_X 2hgu_X 1vsa_S 2j03_Y 2jl6_Y 2jl8_Y 2v47_Y 2v49_Y 2wdi_Y 2wdj_Y 2wdl_Y 2wdn_Y 2wh2_Y 2wh4_Y 2wrj_Y 2wrl_Y 2wro_Y 2wrr_Y ... Back     alignment and structure
Probab=100.00  E-value=1.2e-36  Score=222.76  Aligned_cols=105  Identities=39%  Similarity=0.675  Sum_probs=98.3

Q ss_pred             hcccccCCEEEEeecCCCCcEeeEEEEEccCCEEEEeccceeeeeeCCCC-CCCCceEEEeeeccCCCccccCCCCCCce
Q 031473           12 HWKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVKKHIKGGE-GHEGGIFTVEAPIHASNVQVLDPVTGKPC   90 (159)
Q Consensus        12 ~~~i~kGD~V~Vi~G~dKGk~G~V~~V~~~~~~V~Vegvn~~~~~~k~~~-~~~g~i~~~e~pI~~SnV~Lvdp~~g~~~   90 (159)
                      .|+|++||+|+||+|+|||++|+|++|++++++|+|||+|+.++|++|++ +.+|+++++|+|||+|||+|+||++++++
T Consensus         4 k~~IkkGD~V~Vi~GkdKGk~GkV~~V~~~~~~ViVEGvN~~kkh~kp~~~~~~Ggi~~~E~PIh~SNV~lv~p~~~k~t   83 (110)
T 3v2d_Y            4 KMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRVSPKYPQGGFIEKEAPLHASKVRPICPACGKPT   83 (110)
T ss_dssp             CCSCCTTSEEEECSSTTTTCEEEEEEEEGGGTEEEETTSSEEEEECCSSSSSTTCCEEEEECCEEGGGEEEBCTTTCSBC
T ss_pred             ccccCCCCEEEEeEcCCCCeEeEEEEEECCCCEEEEeCEEEEEEEeCCCccCCCCCEEEEECCcCHHHeEEEcCcCCCcc
Confidence            68999999999999999999999999999999999999999999999986 56899999999999999999999999999


Q ss_pred             eEEEEEccCCcEEEEEEecCCCCeeecCC
Q 031473           91 KVGTKYLEDGTKVRVARGIGASGSIIPRP  119 (159)
Q Consensus        91 rV~~~~~~~g~k~R~~k~~~~~~~~IPwP  119 (159)
                      ||+|++++||+++|+|+   .||.+|+.|
T Consensus        84 Rvg~~~~edG~kvRv~k---k~g~~i~~~  109 (110)
T 3v2d_Y           84 RVRKKFLENGKKIRVCA---KCGGALDTE  109 (110)
T ss_dssp             CEEEEECSSCCEEEEES---SSCCBCC--
T ss_pred             EEEEEECCCCcEEEEEe---cCCCccCCC
Confidence            99999999999999999   578888755
>3r8s_U 50S ribosomal protein L24; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 2j28_U* 3fik_U 3j19_U 2wwq_U 3oat_U* 3oas_U* 3ofd_U 3ofc_U 3ofr_U* 3ofz_U* 3og0_U 3ofq_U 3r8t_U 3i1n_U 1vs8_U 1vs6_U 1vt2_U 3i1p_U 3i1r_U 3i1t_U ... Back     alignment and structure
>2ftc_N Mitochondrial ribosomal protein L24; mitochondrial ribosome, large ribosomal subunit, ribosomal R ribosome; 12.10A {Bos taurus} PDB: 3iy9_N Back     alignment and structure
>2zjr_R 50S ribosomal protein L24; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.34.5.1 PDB: 1nwx_S* 1nwy_S* 1sm1_S* 1xbp_S* 2d3o_S 2zjp_R* 2zjq_R 1nkw_S 3cf5_R* 3dll_R* 3pio_R* 3pip_R* 1pnu_S 1pny_S 1vor_V 1vou_V 1vow_V 1voy_V 1vp0_V Back     alignment and structure
>3bbo_W Ribosomal protein L24; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>1vq8_T 50S ribosomal protein L24P; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: b.34.5.1 PDB: 1vq4_T* 1vq5_T* 1vq6_T* 1vq7_T* 1s72_T* 1vq9_T* 1vqk_T* 1vql_T* 1vqm_T* 1vqn_T* 1vqo_T* 1vqp_T* 1yhq_T* 1yi2_T* 1yij_T* 1yit_T* 1yj9_T* 1yjn_T* 1yjw_T* 2otj_T* ... Back     alignment and structure
>3j21_U 50S ribosomal protein L24P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2zkr_t 60S ribosomal protein L26; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>3u5e_Y L33, YL33, 60S ribosomal protein L26-A; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 2wwa_L 2ww9_L 2wwb_L 3o5h_X 3o58_X 3u5i_Y 4b6a_Y 1s1i_U 3izc_Y 3izs_Y 3jyw_U Back     alignment and structure
>4a17_S RPL26, 60S ribosomal protein L21; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_S 4a1c_S 4a1e_S Back     alignment and structure
>1nz9_A Transcription antitermination protein NUSG; transcription elongation, riken structural genomics/proteomics initiative, RSGI; NMR {Thermus thermophilus} SCOP: b.34.5.4 Back     alignment and structure
>3p8b_B Transcription antitermination protein NUSG; transcription elongation factor, RNA polymerase, transferase transcription complex; 1.80A {Pyrococcus furiosus} PDB: 3qqc_D Back     alignment and structure
>2e6z_A Transcription elongation factor SPT5; KOW motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvv_A Transcription antitermination protein NUSG; transcription factor, transcription regulation, transcription termination; NMR {Escherichia coli} PDB: 2k06_A 2kvq_G Back     alignment and structure
>2do3_A Transcription elongation factor SPT5; KOW motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.5.5 Back     alignment and structure
>2ckk_A KIN17; beta barrel, ribosomal protein, ribonucleoprotein, nuclear protein; 1.45A {Homo sapiens} Back     alignment and structure
>2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} Back     alignment and structure
>1m1h_A Transcription antitermination protein NUSG; transcription termination, RNP motif, immunoglobulin fold, nucleic acid interaction; 1.95A {Aquifex aeolicus} SCOP: b.114.1.1 d.58.42.1 PDB: 1m1g_A 1npp_A 1npr_A Back     alignment and structure
>4a18_F RPL14; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_F 4a1b_F 4a1d_F 4adx_7 Back     alignment and structure
>2joy_A 50S ribosomal protein L14E; protein solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Sulfolobus solfataricus} SCOP: b.34.5.7 PDB: 2kds_A Back     alignment and structure
>2e70_A Transcription elongation factor SPT5; KOW motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a18_N RPL27, ribosomal protein L22; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_N 4a1b_N 4a1d_N Back     alignment and structure
>3j21_5 50S ribosomal protein L14E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>4a18_E RPL6; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_E 4a1b_E 4a1d_E Back     alignment and structure
>3iz6_D 40S ribosomal protein S4 (S4E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1qp2_A Protein (PSAE protein); mainly beta, roll, pleckstrin topology, SH3-like, electron T; NMR {Nostoc SP} SCOP: b.34.4.2 PDB: 1qp3_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 159
d2j01y1101 b.34.5.1 (Y:2-102) Ribosomal proteins L24 (L24p) { 1e-28
d2gycs199 b.34.5.1 (S:3-101) Ribosomal proteins L24 (L24p) { 1e-26
d2zjrr1110 b.34.5.1 (R:4-113) Ribosomal proteins L24 (L24p) { 5e-26
d1vqot1119 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) { 1e-20
>d2j01y1 b.34.5.1 (Y:2-102) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]} Length = 101 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: Translation proteins SH3-like domain
family: Ribosomal proteins L24p and L21e
domain: Ribosomal proteins L24 (L24p)
species: Thermus thermophilus [TaxId: 274]

 Score = 99.8 bits (249), Expect = 1e-28
 Identities = 40/96 (41%), Positives = 59/96 (61%), Gaps = 1/96 (1%)

Query: 13  WKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVKKHIKGGEGH-EGGIFTVE 71
             + +GD V++  GK KG  G +K V+  +  VIVEG N+VKK ++    + +GG    E
Sbjct: 4   MHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRVSPKYPQGGFIEKE 63

Query: 72  APIHASNVQVLDPVTGKPCKVGTKYLEDGTKVRVAR 107
           AP+HAS V+ + P  GKP +V  K+LE+G K+RV  
Sbjct: 64  APLHASKVRPICPACGKPTRVRKKFLENGKKIRVCA 99
>d2gycs1 b.34.5.1 (S:3-101) Ribosomal proteins L24 (L24p) {Escherichia coli [TaxId: 562]} Length = 99 Back     information, alignment and structure
>d2zjrr1 b.34.5.1 (R:4-113) Ribosomal proteins L24 (L24p) {Deinococcus radiodurans [TaxId: 1299]} Length = 110 Back     information, alignment and structure
>d1vqot1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 119 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
d2zjrr1110 Ribosomal proteins L24 (L24p) {Deinococcus radiodu 100.0
d2j01y1101 Ribosomal proteins L24 (L24p) {Thermus thermophilu 100.0
d2gycs199 Ribosomal proteins L24 (L24p) {Escherichia coli [T 99.97
d1vqot1119 Ribosomal proteins L24 (L24p) {Archaeon Haloarcula 99.89
d1nppa258 N-utilization substance G protein NusG, C-terminal 98.08
d1nz9a_58 N-utilization substance G protein NusG, C-terminal 98.02
d2do3a162 Transcription elongation factor SPT5 {Human (Homo 97.05
d2joya196 Ribosomal protein L14e {Sulfolobus solfataricus [T 91.04
d1vhka172 Hypothetical protein YqeU {Bacillus subtilis [TaxI 85.55
d1nxza172 Hypothetical protein HI0303 {Haemophilus influenza 84.57
>d2zjrr1 b.34.5.1 (R:4-113) Ribosomal proteins L24 (L24p) {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: Translation proteins SH3-like domain
family: Ribosomal proteins L24p and L21e
domain: Ribosomal proteins L24 (L24p)
species: Deinococcus radiodurans [TaxId: 1299]

Probab=100.00  E-value=1.1e-35  Score=216.04  Aligned_cols=104  Identities=36%  Similarity=0.580  Sum_probs=96.5

Q ss_pred             hcchhcccccCCEEEEeecCCCCcEeeEEEEEccCCEEEEeccceeeeeeCCCC-CCCCceEEEeeeccCCCccccCCCC
Q 031473            8 KLIRHWKILRGDNVMIIRGKDKGETGAIKRVIRSQNRVIVEGKNLVKKHIKGGE-GHEGGIFTVEAPIHASNVQVLDPVT   86 (159)
Q Consensus         8 ~~ir~~~i~kGD~V~Vi~G~dKGk~G~V~~V~~~~~~V~Vegvn~~~~~~k~~~-~~~g~i~~~e~pI~~SnV~Lvdp~~   86 (159)
                      +.-.+|+|++||+|+||+|+|||++|+|++|++++|+|+|||+|+.++|+++++ +.+||++++|+|||+|||+|+||.+
T Consensus         6 ~~~~K~kikkGD~V~VisGkdKGk~G~Vl~V~~~~~~ViVeGvN~~kkh~Kp~~~~~~Ggiv~~E~PIhiSNV~lvdp~~   85 (110)
T d2zjrr1           6 HHNDKLHFKKGDTVIVLSGKHKGQTGKVLLALPRDQKVVVEGVNVITKNVKPSMTNPQGGQEQRELALHASKVALVDPET   85 (110)
T ss_dssp             TTTSCCSSCTTSEEECCSSSSTTCEEEEEEEETTTTEEEESSSCBCCCCCCTTSSSCCCCCCCBCCCBCSSSEECBSSSS
T ss_pred             cccceeeeeCCCEEEEeecCCCCcceEEEEEECCCCEEEEeCcEEEEEEecccccCCCCCeEeeeeeEEhhhEEEEcCCC
Confidence            445679999999999999999999999999999999999999999999999985 4579999999999999999999999


Q ss_pred             CCceeEEEEEccCCcEEEEEEecCCC
Q 031473           87 GKPCKVGTKYLEDGTKVRVARGIGAS  112 (159)
Q Consensus        87 g~~~rV~~~~~~~g~k~R~~k~~~~~  112 (159)
                      ++++||+|++ +||+++|+|++|++|
T Consensus        86 ~k~trv~~~~-~dGkKvRv~kksGes  110 (110)
T d2zjrr1          86 GKATRVRKQI-VDGKKVRVAVASGKT  110 (110)
T ss_dssp             BCCCCCCCCC-SCTTSCCCCSSSCCC
T ss_pred             CCceEEEEEE-eCCeEEEEEecCCCC
Confidence            9999999986 689999999987654
>d2j01y1 b.34.5.1 (Y:2-102) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gycs1 b.34.5.1 (S:3-101) Ribosomal proteins L24 (L24p) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vqot1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1nppa2 b.34.5.4 (A:191-248) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1nz9a_ b.34.5.4 (A:) N-utilization substance G protein NusG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2do3a1 b.34.5.5 (A:462-523) Transcription elongation factor SPT5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2joya1 b.34.5.7 (A:1-96) Ribosomal protein L14e {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vhka1 b.122.1.2 (A:2-73) Hypothetical protein YqeU {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nxza1 b.122.1.2 (A:2-73) Hypothetical protein HI0303 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure