Citrus Sinensis ID: 031493


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MFRWFQIELARDMGYTAARFGHVMFPENVYEPALECAELLLQGVGKGWASRAYFSDNGSTAIEIALKMAFRKFSFDHDVLVDFLGKDTTEKCVELKHLKDHIMVILWVPWKLKHHHLTQGFCSNHGTLEEAFFWTLLQFSCTTANGFFPYLNCCIPKL
ccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccEEEECcccHHHHHHHHHHHHHHHHHccccccEEEEccccccEEEEEEccccEEEEEECccccccccccccccccccccHHHHHHHEEEEEcccccccccccccccccc
MFRWFQIELARDMGYTAARFGHVMFPENVYEPALECAELLLQGVGKGWASRAYFSDNGSTAIEIALKMAFRKFSFDHDVLVDFLGKDTTEKCVELKHLKDHIMVILWVPWKLKHHHLTQGFCSNHGTLEEAFFWTLLQFSCTTANGFFPYLNCCIPKL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFRWFQIELARDMGYTAARFGHVMFPENVYEPALECAELLLQGVGKGWASRAYFSDNGSTAIEIALKMAFRKFSFDHDVLVDFLGKDTTEKCVELKHLKDHIMVILWVPWKLKHHHLTQGFCSNHGTLEEAFFWTLLQFSCTTANGFFPYLNCCIPKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial Catalyzes the transfer of the alpha-amino group from S-adenosyl-L-methionine (SAM) to 7-keto-8-aminopelargonic acid (KAPA) to form 7,8-diaminopelargonic acid (DAPA). It is the only animotransferase known to utilize SAM as an amino donor.probableQ6ZKV8
Bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial Catalyzes the transfer of the alpha-amino group from S-adenosyl-L-methionine (SAM) to 7-keto-8-aminopelargonic acid (KAPA) to form 7,8-diaminopelargonic acid (DAPA). It is the only animotransferase known to utilize SAM as an amino donor.probableB0F481

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A0G, chain A
Confidence level:very confident
Coverage over the Query: 1-99,110-127
View the alignment between query and template
View the model in PyMOL
Template: 4E3Q, chain A
Confidence level:confident
Coverage over the Query: 1-99,110-150
View the alignment between query and template
View the model in PyMOL