Citrus Sinensis ID: 031497


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MDYQPNTSLHLSLPSNQLNLDLVLEPSPSSNCSSPSPHSPAAEPRIFSCNYCQRKFYSSQALGGHQNAHKLERTLAKKSKEFSSAVRAHGVSNNPRSGSSSIGSSSHASRIHQGHAHAGKFAGEFDYGIREVNYSSMSYSPHENVQDELSQLDLSLRL
cccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccEcccccccccccccccccccccccccEEEEccccccccccHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccEEEcc
mdyqpntslhlslpsnqlnldlvlepspssncsspsphspaaeprifscnycqrkfyssqalgghqnaHKLERTLAKKSKEFSSAVRahgvsnnprsgsssigssshasrihqghahagkfagefdygirevnyssmsysphenvqdELSQLDLSLRL
mdyqpntslhlslpSNQLNLDLVLEPSPSSNCSSPSPHSPAAEPRIFSCNYCQRKFYSSQALGGHQNAHKLERTLAKKSKEFSSAVrahgvsnnprsgssSIGSSSHASRIHQGHAHAGKFAGEFDYGIREVNYSSMsysphenvqdelsqldlslrl
MDYQPNTSLHLSLPSNQLNLDLVLEpspssncsspsphspAAEPRIFSCNYCQRKFYSSQALGGHQNAHKLERTLAKKSKEFSSAVRAHGVsnnprsgsssigssshasrihQGHAHAGKFAGEFDYGIREVNYSSMSYSPHENVQDELSQLDLSLRL
*********************************************IFSCNYCQRKFYSS***********************************************************GKFAGEFDYGIREVNY************************
*****NT****************************************SCNYCQRKFYSSQALGGHQNAH**********************************************************************************LDLSLRL
********LHLSLPSNQLNLDLVLE*****************EPRIFSCNYCQRKFYSSQALGGHQNAHKLERTLAKKSKEFSSAVRAH**************************AHAGKFAGEFDYGIREVNYSSMSYSPHENVQDELSQLDLSLRL
*****NTSLHLSLPSNQ*N************************PRIFSCNYCQRKFYSSQALGGHQNAHKLERTLAKKSKEFSSAVRAHGVSNNPRSGSSSIGSSSHASRIHQGHAHAGKFAGEFDYGIREVNY*S*S************QLD*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDYQPNTSLHLSLPSNQLNLDLVLEPSPSSNCSSPSPHSPAAEPRIFSCNYCQRKFYSSQALGGHQNAHKLERTLAKKSKEFSSAVRAHGVSNNPRSGSSSIGSSSHASRIHQGHAHAGKFAGEFDYGIREVNYSSMSYSPHENVQDELSQLDLSLRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query158 2.2.26 [Sep-21-2011]
Q39261150 Zinc finger protein 2 OS= yes no 0.911 0.96 0.536 8e-28
Q39266209 Zinc finger protein 7 OS= no no 0.607 0.459 0.480 8e-16
Q42485228 Zinc finger protein 1 OS= no no 0.284 0.197 0.733 1e-14
Q39263260 Zinc finger protein 4 OS= no no 0.424 0.257 0.589 4e-14
Q39262235 Zinc finger protein 3 OS= no no 0.449 0.302 0.519 9e-14
Q9FFX4161 Zinc finger protein KNUCK no no 0.221 0.217 0.685 5e-09
Q39265197 Zinc finger protein 6 OS= no no 0.424 0.340 0.426 8e-08
Q9LHS9226 Probable transcriptional no no 0.221 0.154 0.514 6e-05
Q38895204 Transcriptional regulator no no 0.189 0.147 0.533 0.0001
Q6S592207 Zinc finger protein JAGGE no no 0.424 0.323 0.328 0.0005
>sp|Q39261|ZFP2_ARATH Zinc finger protein 2 OS=Arabidopsis thaliana GN=ZFP2 PE=2 SV=1 Back     alignment and function desciption
 Score =  122 bits (306), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 88/164 (53%), Positives = 103/164 (62%), Gaps = 20/164 (12%)

Query: 1   MDYQPNTSLHLSLPS---NQLNLDLVLEPSPSSNCSSPSPHSPAA--EPRIFSCNYCQRK 55
           MDYQPNTSL LSLPS   +QLNL+LVLEPS  S+ SS S +S +   +PR+FSCNYCQRK
Sbjct: 1   MDYQPNTSLRLSLPSYKNHQLNLELVLEPSSMSSSSSSSTNSSSCLEQPRVFSCNYCQRK 60

Query: 56  FYSSQALGGHQNAHKLERTLAKKSKE-FSSAVRAHGVSNNPRSGSSSIGSSSHASRIHQG 114
           FYSSQALGGHQNAHKLERTLAKKS+E F S+         P SG   +       R +QG
Sbjct: 61  FYSSQALGGHQNAHKLERTLAKKSRELFRSSNTVDSDQPYPFSGRFEL-----YGRGYQG 115

Query: 115 HAHAGKFAGEFDYGIREVNYSSMSYSPHENVQDELSQLDLSLRL 158
              +G   G  D+  R V  S +      +   E S LDLSLRL
Sbjct: 116 FLESG---GSRDFSARRVPESGL------DQDQEKSHLDLSLRL 150





Arabidopsis thaliana (taxid: 3702)
>sp|Q39266|ZFP7_ARATH Zinc finger protein 7 OS=Arabidopsis thaliana GN=ZFP7 PE=2 SV=1 Back     alignment and function description
>sp|Q42485|ZFP1_ARATH Zinc finger protein 1 OS=Arabidopsis thaliana GN=ZFP1 PE=2 SV=1 Back     alignment and function description
>sp|Q39263|ZFP4_ARATH Zinc finger protein 4 OS=Arabidopsis thaliana GN=ZFP4 PE=2 SV=2 Back     alignment and function description
>sp|Q39262|ZFP3_ARATH Zinc finger protein 3 OS=Arabidopsis thaliana GN=ZFP3 PE=2 SV=1 Back     alignment and function description
>sp|Q9FFX4|KNU_ARATH Zinc finger protein KNUCKLES OS=Arabidopsis thaliana GN=KNU PE=1 SV=1 Back     alignment and function description
>sp|Q39265|ZFP6_ARATH Zinc finger protein 6 OS=Arabidopsis thaliana GN=ZFP6 PE=2 SV=1 Back     alignment and function description
>sp|Q9LHS9|RBE_ARATH Probable transcriptional regulator RABBIT EARS OS=Arabidopsis thaliana GN=RBE PE=2 SV=2 Back     alignment and function description
>sp|Q38895|SUP_ARATH Transcriptional regulator SUPERMAN OS=Arabidopsis thaliana GN=SUP PE=1 SV=1 Back     alignment and function description
>sp|Q6S592|JGL_ARATH Zinc finger protein JAGGED-like OS=Arabidopsis thaliana GN=JGL PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
224126047129 predicted protein [Populus trichocarpa] 0.803 0.984 0.643 9e-40
225446086154 PREDICTED: zinc finger protein 2-like [V 0.930 0.954 0.612 4e-37
224142263126 predicted protein [Populus trichocarpa] 0.797 1.0 0.632 2e-36
255586981155 zinc finger protein, putative [Ricinus c 0.955 0.974 0.611 8e-30
356550750164 PREDICTED: zinc finger protein 2-like [G 0.930 0.896 0.542 6e-28
357479709 268 Zinc finger protein [Medicago truncatula 0.949 0.559 0.517 2e-27
356564852162 PREDICTED: zinc finger protein 2-like [G 0.962 0.938 0.527 3e-27
147860999198 hypothetical protein VITISV_038605 [Viti 0.860 0.686 0.491 6e-27
15242152150 zinc finger protein 2 [Arabidopsis thali 0.911 0.96 0.536 5e-26
297788484140 hypothetical protein ARALYDRAFT_497512 [ 0.772 0.871 0.544 2e-22
>gi|224126047|ref|XP_002329648.1| predicted protein [Populus trichocarpa] gi|222870529|gb|EEF07660.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  168 bits (425), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 111/160 (69%), Gaps = 33/160 (20%)

Query: 1   MDYQPNTSLHLSLPSNQLNLDLVLEPSPSSNCSSPSPHSPAAEPRIFSCNYCQRKFYSSQ 60
           MD+QPNTSLHLSLPSNQLNL+LVLEPS SS+  SP      AEPRIFSCNYCQRKFYSSQ
Sbjct: 1   MDFQPNTSLHLSLPSNQLNLELVLEPSSSSSRHSP------AEPRIFSCNYCQRKFYSSQ 54

Query: 61  ALGGHQNAHKLERTLAKKSKEFSSAVRAHGVSNNPRSGSSSIGSSSHASRIHQGHAHAGK 120
           ALGGHQNAHKLERTLAKKS+E SS+VRAHG S NPR G +                    
Sbjct: 55  ALGGHQNAHKLERTLAKKSREMSSSVRAHGGS-NPRYGRT-------------------- 93

Query: 121 FAGEFDYGIRE--VNYSSMSYSPHENVQDELSQLDLSLRL 158
              E +YG RE      SM Y   ENVQ+ELSQLDLSLRL
Sbjct: 94  ---EMNYGSREGIGGSWSMVYRT-ENVQEELSQLDLSLRL 129




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225446086|ref|XP_002273296.1| PREDICTED: zinc finger protein 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224142263|ref|XP_002324478.1| predicted protein [Populus trichocarpa] gi|222865912|gb|EEF03043.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255586981|ref|XP_002534087.1| zinc finger protein, putative [Ricinus communis] gi|223525873|gb|EEF28297.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356550750|ref|XP_003543747.1| PREDICTED: zinc finger protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|357479709|ref|XP_003610140.1| Zinc finger protein [Medicago truncatula] gi|355511195|gb|AES92337.1| Zinc finger protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356564852|ref|XP_003550661.1| PREDICTED: zinc finger protein 2-like [Glycine max] Back     alignment and taxonomy information
>gi|147860999|emb|CAN80869.1| hypothetical protein VITISV_038605 [Vitis vinifera] Back     alignment and taxonomy information
>gi|15242152|ref|NP_200560.1| zinc finger protein 2 [Arabidopsis thaliana] gi|27923888|sp|Q39261.1|ZFP2_ARATH RecName: Full=Zinc finger protein 2 gi|790675|gb|AAA87298.1| zinc finger protein [Arabidopsis thaliana] gi|9758313|dbj|BAB08787.1| CCHH finger protein 2-like protein [Arabidopsis thaliana] gi|88900400|gb|ABD57512.1| At5g57520 [Arabidopsis thaliana] gi|332009527|gb|AED96910.1| zinc finger protein 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297788484|ref|XP_002862338.1| hypothetical protein ARALYDRAFT_497512 [Arabidopsis lyrata subsp. lyrata] gi|297307748|gb|EFH38596.1| hypothetical protein ARALYDRAFT_497512 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
TAIR|locus:2174547150 ZFP2 "AT5G57520" [Arabidopsis 0.911 0.96 0.475 6.6e-26
TAIR|locus:2183780272 AT5G10970 "AT5G10970" [Arabido 0.436 0.253 0.528 2e-16
TAIR|locus:2146960235 ZFP3 "AT5G25160" [Arabidopsis 0.316 0.212 0.64 2e-16
TAIR|locus:2025777228 ZFP1 "AT1G80730" [Arabidopsis 0.430 0.298 0.544 2.6e-15
TAIR|locus:2825107209 ZFP7 "AT1G24625" [Arabidopsis 0.462 0.349 0.519 5.4e-15
TAIR|locus:2013820260 ZFP4 "AT1G66140" [Arabidopsis 0.525 0.319 0.494 1.8e-14
TAIR|locus:2159088161 KNU "AT5G14010" [Arabidopsis t 0.240 0.236 0.657 8.6e-13
TAIR|locus:2095883253 GIS "AT3G58070" [Arabidopsis t 0.215 0.134 0.705 8.3e-11
TAIR|locus:2181007215 AT5G01860 "AT5G01860" [Arabido 0.253 0.186 0.625 2e-10
TAIR|locus:2156529173 LATE "LATE FLOWERING" [Arabido 0.227 0.208 0.722 3.2e-10
TAIR|locus:2174547 ZFP2 "AT5G57520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 293 (108.2 bits), Expect = 6.6e-26, P = 6.6e-26
 Identities = 78/164 (47%), Positives = 88/164 (53%)

Query:     1 MDYQPNTSLHLSLPS---NQLNLDLVLEXXXXXXXXXXXXXXXAA--EPRIFSCNYCQRK 55
             MDYQPNTSL LSLPS   +QLNL+LVLE               +   +PR+FSCNYCQRK
Sbjct:     1 MDYQPNTSLRLSLPSYKNHQLNLELVLEPSSMSSSSSSSTNSSSCLEQPRVFSCNYCQRK 60

Query:    56 FYSSQALGGHQNAHKLERTLAKKSKEFSSAVRAHGVXXXXXXXXXXXXXXXXXXXXXQGH 115
             FYSSQALGGHQNAHKLERTLAKKS+E     R+                        QG 
Sbjct:    61 FYSSQALGGHQNAHKLERTLAKKSREL---FRSSNTVDSDQPYPFSGRFELYGRGY-QGF 116

Query:   116 AHAGKFAGEFDYGIREVNYSSMSYSPHENVQD-ELSQLDLSLRL 158
               +G   G  D+  R V  S +        QD E S LDLSLRL
Sbjct:   117 LESG---GSRDFSARRVPESGLD-------QDQEKSHLDLSLRL 150




GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2183780 AT5G10970 "AT5G10970" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146960 ZFP3 "AT5G25160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025777 ZFP1 "AT1G80730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825107 ZFP7 "AT1G24625" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013820 ZFP4 "AT1G66140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159088 KNU "AT5G14010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095883 GIS "AT3G58070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181007 AT5G01860 "AT5G01860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156529 LATE "LATE FLOWERING" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q39261ZFP2_ARATHNo assigned EC number0.53650.91130.96yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 158
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 98.73
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 98.55
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 97.92
PHA0061644 hypothetical protein 97.73
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 97.64
PHA0276855 hypothetical protein; Provisional 97.57
KOG3576267 consensus Ovo and related transcription factors [T 97.3
KOG1074958 consensus Transcriptional repressor SALM [Transcri 97.12
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 97.11
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.97
PHA00733128 hypothetical protein 96.8
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.67
KOG3576267 consensus Ovo and related transcription factors [T 96.62
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 96.17
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.04
smart0035526 ZnF_C2H2 zinc finger. 95.71
PHA0073279 hypothetical protein 95.63
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 95.06
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 93.81
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 93.45
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 92.29
KOG3993500 consensus Transcription factor (contains Zn finger 91.77
KOG3608467 consensus Zn finger proteins [General function pre 91.27
PRK04860160 hypothetical protein; Provisional 89.35
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 88.41
KOG3608467 consensus Zn finger proteins [General function pre 87.89
PLN03086567 PRLI-interacting factor K; Provisional 87.09
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 86.21
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 84.55
PLN03086567 PRLI-interacting factor K; Provisional 84.3
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=98.73  E-value=6.7e-09  Score=88.28  Aligned_cols=53  Identities=19%  Similarity=0.349  Sum_probs=45.2

Q ss_pred             cceecCccccccCCchhhhcccccccCCCcccc----ccc----chHHHHHhhCCCCCCCC
Q 031497           45 RIFSCNYCQRKFYSSQALGGHQNAHKLERTLAK----KSK----EFSSAVRAHGVSNNPRS   97 (158)
Q Consensus        45 KPykC~eCgK~FsssqsL~~Hqr~HtgEKp~~~----~s~----~~~s~lr~H~~~~~~~s   97 (158)
                      -+++|..|||.|....-|++|+|+|||||||.|    |+|    +|..||++|..-+.+++
T Consensus       186 l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC  246 (279)
T KOG2462|consen  186 LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQC  246 (279)
T ss_pred             CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccC
Confidence            378999999999999999999999999999999    444    57778888888777765



>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
2l1o_A39 Zinc To Cadmium Replacement In The A. Thaliana Supe 2e-04
>pdb|2L1O|A Chain A, Zinc To Cadmium Replacement In The A. Thaliana Superman Cys2his2 Zinc Finger Induces Structural Rearrangements Of Typical Dna Base Determinant Positions Length = 39 Back     alignment and structure

Iteration: 1

Score = 41.6 bits (96), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 15/26 (57%), Positives = 22/26 (84%) Query: 44 PRIFSCNYCQRKFYSSQALGGHQNAH 69 PR ++C++C+R+F S+QALGGH N H Sbjct: 4 PRSYTCSFCKREFRSAQALGGHMNVH 29

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 2e-17
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Length = 39 Back     alignment and structure
 Score = 70.6 bits (173), Expect = 2e-17
 Identities = 16/34 (47%), Positives = 26/34 (76%)

Query: 44 PRIFSCNYCQRKFYSSQALGGHQNAHKLERTLAK 77
          PR ++C++C+R+F S+QALGGH N H+ +R   +
Sbjct: 4  PRSYTCSFCKREFRSAQALGGHMNVHRRDRARLR 37


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.3
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.01
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.01
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 98.94
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 98.9
2lv2_A85 Insulinoma-associated protein 1; structural genomi 98.85
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 98.82
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.8
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.79
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.76
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 98.75
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.75
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.74
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.72
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.72
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.72
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.71
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.71
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.71
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.7
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.7
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 98.7
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.7
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.7
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.69
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.69
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.69
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.69
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.69
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.69
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 98.69
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.69
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.69
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.69
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.69
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.69
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.68
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.68
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.68
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.68
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.67
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.67
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.67
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.67
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.67
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.67
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.67
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 98.67
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.67
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.67
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.67
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.67
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 98.67
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.66
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.66
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.66
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.66
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.66
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.66
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.66
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.65
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.65
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.65
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.65
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.65
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.65
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.65
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.65
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.64
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.64
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.64
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.64
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.63
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.63
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.63
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.63
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.63
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.63
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.63
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.63
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.63
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.63
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.63
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 98.63
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.63
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.63
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.63
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.63
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.62
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.62
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.62
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 98.62
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.62
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.62
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.62
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.62
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.62
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.61
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.61
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.61
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.61
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.61
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.61
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.6
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.6
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.6
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.6
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.6
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.6
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.6
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.6
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.6
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.59
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.59
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.58
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.58
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.57
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 98.56
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.54
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 98.53
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.52
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 98.5
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 98.49
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.49
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.49
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 98.48
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 98.48
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 98.48
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.48
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.46
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.45
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.45
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 98.44
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.43
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.41
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.41
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 98.39
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 98.39
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.37
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.37
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 98.36
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 98.34
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 98.34
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.33
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.32
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.32
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 98.31
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 98.29
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 98.29
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.28
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 98.27
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 98.26
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 98.26
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 98.26
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.58
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 98.25
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 98.25
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.24
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.54
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.22
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.21
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 98.21
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 98.21
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.2
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 98.2
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 98.2
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 98.19
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.19
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.18
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 98.17
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 98.16
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 98.16
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.16
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.15
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.15
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.15
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.14
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 98.13
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 98.13
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.11
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.09
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.06
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.04
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 98.04
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.03
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 98.0
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 97.99
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 97.97
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 97.97
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.95
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 97.95
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 97.94
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.93
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.15
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 97.88
1tf6_A190 Protein (transcription factor IIIA); complex (tran 97.86
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 97.85
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 97.78
1tf6_A190 Protein (transcription factor IIIA); complex (tran 97.73
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 97.72
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.71
1vd4_A62 Transcription initiation factor IIE, alpha subunit 97.71
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 97.67
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 97.67
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 97.67
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 97.63
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 97.62
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 97.57
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 97.56
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 97.51
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 97.47
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 97.43
2lv2_A85 Insulinoma-associated protein 1; structural genomi 97.43
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 97.38
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 97.38
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 97.19
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 97.19
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 97.19
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 97.18
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 97.12
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 97.08
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 97.04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 96.99
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.96
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.91
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.91
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.9
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 96.89
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 96.89
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 96.87
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 96.86
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 96.86
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.83
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 96.83
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.83
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 96.82
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.82
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 96.82
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.82
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.82
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.81
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.81
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.81
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.8
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.8
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 96.79
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.79
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.78
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.78
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 96.77
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.76
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.76
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 96.74
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.73
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.73
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.72
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.72
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 96.72
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.72
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 96.71
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.71
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.71
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.71
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 96.71
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.71
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 96.7
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.7
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 96.69
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.69
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.69
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.69
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 96.68
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.67
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 96.66
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 96.66
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 96.65
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 96.64
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.64
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 96.64
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.64
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 96.63
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 96.62
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.61
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 96.61
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.6
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 96.6
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.6
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 96.59
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.59
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.59
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 96.58
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 96.58
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 96.57
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 96.57
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 96.56
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 96.56
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.55
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 96.55
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.54
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 96.54
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.53
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 96.53
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 96.52
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 96.51
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 96.51
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.5
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.48
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.48
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 96.47
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 96.43
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 96.35
2epa_A72 Krueppel-like factor 10; transforming growth facto 96.35
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 96.34
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 96.2
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 96.02
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 95.93
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 95.78
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 95.51
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.23
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 94.9
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 94.89
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 94.68
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 94.61
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 94.54
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 94.26
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 94.22
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 94.05
1vd4_A62 Transcription initiation factor IIE, alpha subunit 93.73
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 93.54
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 93.31
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 93.28
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 93.14
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 92.96
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 92.91
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.79
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 92.68
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.98
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.91
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.51
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 90.95
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 90.56
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.91
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 88.8
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 88.41
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 86.8
2e72_A49 POGO transposable element with ZNF domain; zinc fi 82.53
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 82.14
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
Probab=99.30  E-value=3.7e-13  Score=88.50  Aligned_cols=50  Identities=24%  Similarity=0.450  Sum_probs=44.4

Q ss_pred             CcceecCccccccCCchhhhcccccccCCCcccc--------cccchHHHHHhhCCCC
Q 031497           44 PRIFSCNYCQRKFYSSQALGGHQNAHKLERTLAK--------KSKEFSSAVRAHGVSN   93 (158)
Q Consensus        44 eKPykC~eCgK~FsssqsL~~Hqr~HtgEKp~~~--------~s~~~~s~lr~H~~~~   93 (158)
                      ||||+|.+|++.|.....|..|+++|+++|||.|        +...|..|+++|.+++
T Consensus         2 EKpy~C~~C~k~F~~~~~L~~H~~~Ht~ekp~~C~~C~k~F~~~~~L~~H~~~Htgep   59 (60)
T 4gzn_C            2 ERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQSEVNRHLKVHQNKP   59 (60)
T ss_dssp             CCCEECTTTCCEESSHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHGGGGSCC-
T ss_pred             CCCccCCCCCCEeCCHHHHHHHHHHhCCCcCeECCCCCCCcCCHHHHHHHhCccCCCC
Confidence            7999999999999999999999999999999998        3456788888888764



>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 158
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 4e-12
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Plant C2H2 finger (QALGGH zinc finger)
domain: SUPERMAN zinc finger domain
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 55.1 bits (133), Expect = 4e-12
 Identities = 16/35 (45%), Positives = 26/35 (74%)

Query: 43 EPRIFSCNYCQRKFYSSQALGGHQNAHKLERTLAK 77
           PR ++C++C+R+F S+QALGGH N H+ +R   +
Sbjct: 2  PPRSYTCSFCKREFRSAQALGGHMNVHRRDRARLR 36


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.12
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.03
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.89
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.83
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.82
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.82
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.74
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.7
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.64
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.64
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.49
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.47
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.44
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.44
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.41
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.4
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.29
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 98.15
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.1
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.09
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.97
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.82
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.78
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.67
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.63
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 97.55
d2cota238 Zinc finger and SCAN domain-containing protein 16, 97.5
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.44
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.4
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.19
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 97.18
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 96.93
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.89
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.89
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 96.71
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.65
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.62
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 96.51
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.41
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 96.38
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.28
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.22
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.69
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 95.51
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.03
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.65
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.65
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 94.56
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.2
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 93.96
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.56
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 93.14
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 92.61
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 92.18
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 91.59
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 91.28
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 91.2
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 91.0
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 90.79
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 90.43
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 88.96
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 88.62
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 87.8
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 83.45
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 83.22
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 81.75
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 81.71
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.12  E-value=5.7e-12  Score=79.25  Aligned_cols=45  Identities=18%  Similarity=0.373  Sum_probs=38.5

Q ss_pred             CcceecCccccccCCchhhhcccccccCCCcccc----ccc----chHHHHHhh
Q 031497           44 PRIFSCNYCQRKFYSSQALGGHQNAHKLERTLAK----KSK----EFSSAVRAH   89 (158)
Q Consensus        44 eKPykC~eCgK~FsssqsL~~Hqr~HtgEKp~~~----~s~----~~~s~lr~H   89 (158)
                      ||||+| +|++.|.....|..|+++|++++||.|    ++|    .+..||++|
T Consensus         1 EK~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            689999 599999999999999999999999998    344    566666665



>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure