Citrus Sinensis ID: 031522


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MMANLYVKATPPADLNRNTEWFTYPGVWTTYILILFFAWLIVLSVFGCSPGMAWTIVNLAHFLITYHFFHWKKGTPFAEDQGIYNGLTWWEQIDNGQQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFFNTLAVFVLVVAKFPNMHKVRIFGINADK
ccccEEEEccccccccccccEECcccHHHHHHHHHHHHHHHHHHHccccccccEEEEHHHHHHHHEEEEEECcccccccccccccccccEEEEccccccccccEEEEEHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccCEEEEEEcccc
********ATPPADLNRNTEWFTYPGVWTTYILILFFAWLIVLSVFGCSPGMAWTIVNLAHFLITYHFFHWKKGTPFAEDQGIYNGLTWWEQIDNGQQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFFNTLAVFVLVVAKFPNMHKVRIFGIN***
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMANLYVKATPPADLNRNTEWFTYPGVWTTYILILFFAWLIVLSVFGCSPGMAWTIVNLAHFLITYHFFHWKKGTPFAEDQGIYNGLTWWEQIDNGQQLTRNRKFLTVVPVVLYLIASHTTDYQHPMLFFNTLAVFVLVVAKFPNMHKVRIFGINADK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ORM1-like protein 3 Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling.probableD2I2F3
ORM1-like protein Negative regulator of sphingolipid synthesis.probableQ9VP04
ORM1-like protein 3 Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling.probableQ5R570

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted